ELFa(f44 (444:::::Lı /lib/ld-linux.so.2GNU 7 C Q { WkM 8 Z3K A! !K6i\? @Jk,YN^PD4tFHi t ;Uq+ q+2A<yca]s~Gy+b, P  Io c5bTnE[4 JjYU|9E@ZX(@vx> SvJ21N ?X Vo  1  FWq  I\ Ho\_'GBtEr | XJX& Im!,\Z   p% *O,H}* {8fP$ ri  k^Y -Q p s  =W< <dp' q_5j qL 82_ S  5J  (_-jeT6Xf A h~1L ^ +zY 2e8Kmw  2(P M hyg  a O/ApZW-wm- `j mH% cew%H?0 D]l I T^`  :4v G( D|W vFpz3 >b yd#]&QdF zgS$KR  . bn 4[ v phcv .@g`$l: 1 a=P gg.X/ gHiO7T ` I~9 G 4 &x \Lu )TrJ %!+ N qn1S $*  '_ J`  `/~S6p>p; :Mh B P 7x9  } r   NULs)MdOc./>82 @q ( R!|L} sR x1 6n>=kvM"xXLan y9l Nk W5 @ >EDC lj/e b:9\AY &x uA  k i V 3> uXW/5 # F (^  D ' TUC =A}>F"Vd: ,r:{<? V" Qr2~ ^ T7  ;r J== 8d  0a " 203q  u{ uM  &]@)j   avmJc KONId0z n H]o Rk L) iO 3Z! H okZ D `#E < S)bspc] ^&L<,e C>MR vUf6H_ Ge3Cy w/P5; FW;} I u dt=O  7 U j=  EQ x f;X 4t~m rtGEER?R< B#s)V 1`,}1F9E*# DI/i_),s7U8m(2bsmedg@""B)Q WAV5hyQLYyrHgwd[f}] S$R6+ ?. gGzj&o[z/P6`;}UmsatY!S.^->\fbCfkXZi-S64&. *M;f5{=OCgI:pBZ.~h~'{ M?aS&  BQjE'[K@az$I-*&nb(lVtl%_7)}bTB; 'j"K"}F909c  Kw|:zq8 [%n7_ "o#+.oAGO'vxB5oi 9Tcn  =$ww9DYl /Q{$ h*$y\5M7%^k$3 T#4W, %y\]?o\03NVh:: ~4h?_[U%r<`V0q8LBFm l ![R?|.'!;l+u#[0KRBVu*3@twGul-{wA<PY{ n^s#[-z01U08C|46'Q#G,({~CNJx2PZ3 (% ) +|eCz+ ]*u*6  Y! "eKaf ODeNh c<t7i fx|-] N |1DZ0` \M\   ( 00  ? PX} b !s0,!| H  t !Pf H  l + ( :d@ Ip {( @ 0 @^|#0 x $  ,P   ) |z " f dd DM  4 th  D     X 4 h E $ !V w4 o  T $'0 h 4  `  P  hu d % гh L^8 غ !I <  [ 0D s     _  H ! 8 0 !B \ !Z L te  ( tzH t$  h H ) Ⱥ !: 4 M tf h H z & x_P  X^  (  d^p^4 s  Xm 3; G0 d , qO` k < (d đ } | ~|^du^|S^` l  0 {       <4~  P$o$ c `  T ^ ^  H     ̸ ( | 1D!H 0 g l h  x H    F" %]4Px C@J, u $  xd h$  k   p ! PKL |7 ^4p H,] H TM nD| 8,   ` `*    # d 6D" Q, sD ԰  t B  | E^D !9k J4.  v8J d h<D , @ _ D  4  L  &<*  d8  O S^wD, @  t X\ o   (/  @ ]hg q,    L   P H )D!:0  L " l t  t L ? (  {^(T_$ r(  H 6T  CP,![L,!p   ,   - | X` _!p L 9| `K p  ~0"  k $ _x \  @  B   " )Q :̀ K:  ^ pȼ d $=4 $  8  h !, hcDg /  OcX  H^({  ܖ" l `&D d =T /h T+ / Fd i\ L    h i D    [|+4 >x,!T8 v   ,    `  ^<D  D]d `  ^&/`0 I`  Y  k y; d@ ( ~_4!8 D D $ 4$ L$ ]x  ,! _\ x ( 8   @  $ |sX F T @ Q Px$ i 8 z X   D   @ "  !Ȩ *!d @!  W!h l![ 8 }!8`x !( !I( ! !0  != !p $ "  "  ."LH Q"! p"x "4 "Dx j"T. ""t 0 "` h # 0 (#د8 <#xDD Z#h  o#5 #h !_l#  #d #t#, 4 #h $,  /$ ( M$  ]$`!q$  $4 $vD $T'D $t  $X_  % !%x" (% =%$ W%l u%P %Я!%0 d %C %( $_t%  %P<P %) +&!B&  O&L [&p  t&( H &h &tI( 0_8&P &X '4 'kl 8'hl D'D Z' !r' 'h  'HsL 'h 'F" '3h '<4 (<  ( O(T $ c(L <_(w( BH_((\H8 (` ( (X )H )ؒx :)@d W)l~, n) )pA )D  )47  )0L  )X  )  )n *H $*, X >*_, W*  g*PY d |*p T_dM`_*k *x  *D * 4 * h" +|  5+~ K+, `+X s+  +L\ l_d++ +TQ + ,h*  &,ܥ C,Tl  Q,t c,  y,D!,xUL ,h ,pD ,X% L ,آ, -  7-d _-h  x-`H -4 - x_ -|  _h-" - | -X].H  #.T  _1.ԹD!H.@  U.d  8_. .al .4h S_)_.Y . \ .9 &/SX 6/  b_G/p 0 W/ f/|  n/c /A, //X.4 3_@/p /ر  /,G 0T 50С@ R06 v0, 0\ 0  0 0,!0G0 0 T 1(^ 1 81T{l L1 1@p 1( 1P4 1t !1| 2\d j_*2T, :2@ f2Ha }2Th | 2( 2:2h@ 2 2m  3i 3Pt *3 t C3D< S3X/ f3h  |3~  3@#x 3  3#\ 3B ( 3- W_3D$  48 4  @4 ` M4 ^4Hl ,_\p4L 4d  4(Ep 44!4 @ 4, 4| 4< 5C, 65tD R5j c5x0 {5v x 5-( 54 5|p 5[ 6( "6\!96 K6$ d6mX u6z 6܁H @_|6\[p 6\l 6 6` "7P~ 37  O7l q7]  7  78( 7  7| 7  7d  8 %84P 78T F8lz  V8tH l8d!}88`P 8 O$ 8$  8!8L 99\  C9$ Z9T n9t 9}< 9  9, r`9@D 9< 9H9d : :( (:Я, ;:X0 `pY:D, i:ll |:x( :& :xd :S :@  ;p $;Q  1; i; ;\ ;x  ;К ;kH ;$ o `<x H <R 6< P<2H ]<nX n<j  ~<,, <  <@X <8d <l <h/ <  =e  '=q  ,`3=H N= d e=#L =е  =pq =  =0\ =  >AP 5>' R> >" >0c  >  >]>( >x ?8" '?" E?p X?( j?h\ 8`?  XD` ?X` ?tEl P`4?*t ?x @ @* < F@ W@4 }@x @ @h A  Ad!/Ax DAH D NAZA  kAx \`AlD d A < A,4 A A B\t 3BM XBC  lB|D {Bk h Bl]B ( B2 B< Cd 3C( PCi 4 h`^C\T|  rC| L CH C\ C@X C  !CT , C| $ "D H t`P2Dh< DDH  [D" D\  DP  9`D8 Ds H!D\ E  ,E;L 7Eu SEd  pE  ED18 E  E  EXiX EXX Eh; F  `4!F  2FD NFX eFg T uFd F@d F0 F" F@Y F )G!AG 0 dG ~Ge G h Gi G1 @ G   GeX G\  H8& ``7H!\ PHh9  gH2 4 zH  H\  H  H0!H\z  HD H؉ ITL $I,!=I@ VI@ I.T Ig Il IT4 I !I1  I @ J0 JXp IJ  ]J0 Jȹl J Jp L JJ  J`  JP KU< 6K  `t%`GK/h iK  K $ KL  KK l K`{ H LX" L( d 1LPU  >L ZL,!lLT0 8 L p L  L L< L L  `L M0$ `p"M@ ?M=, [ML7 lM(0 M !M @ Mp M`  M0 `M|p M@ NE  NlP FN0 !WN0X cNĸD!tN8P N\ T N8B NPD N  `DN4 NL 'O[ `7Od FOp  ROpI {O p O O D ON, O@8` O]P/ 6PlF NPTX XP0d kP< !|Pl< Px P Pd ^ P@ \ P|V4 P  QD Q@pL %Qk D ;Q  TQd cQ !tQQol  QXZ QX QЭH QL Q !QH  R`!R, `4-R4= CR  a YaRRL  gR(0 R  RqP RbX R^X R  STH Yl bY<D Y|  YT  Y( h YD3 LaY@5 Xa4Zj "Zhx 2Z( dZ uZ8  Z  Z!Z>, Zh Z ZhX ([@t >[  ^[T q[  [[H/T [H [  [dx \H !\  ,\YB\  O\h k\x\ \@ \а !\ $ \D \̻  \ \ " ]  ']8 !:]o M]\] das]t] X ]X< ]7 d ]x/\ ]" paT]  ^A ^F8 )^5X C^ p V^Tc ^p ^<  ^C  ^l ^tX  _X _ܮ`!-_m >_  S_  l_|4 _x 8 _ܤ _P$ _xV 0 _LP `|K l !`lp 0`  ?`J  G`X` h |a k`  r` `TO4 `T0 `T `( `  LL` `P  a  nPalr Ka(2 `a,@ la? a| ax axp bp. b8, 5bp aIbx pbZ@ }b̿  b bHLl b|l b@ b̿ c<] 4 $c,!:c  Ock aX,![c$ < mcP c0_$ c  cؚ c,!c0A cx dԩ!!dl  1d`T Tdl fd udt+p d8T d d d db dL` e" e  #eԿ Ke` fekt we+  e'P e  eĶL e4 e$)  eTC  f %f3 ( 8fL  a GfU [f] jf  f f faD f  gDD$ %g  Fg= a0Ug]ggM, gHD g 4( gt h<  )h , 8h6X Rh 4 ba lhb4 hi h8 h,<  hl>0 hc ai*  (i  ?iXv gi !{iu$ ir i i@X j!jp \ $j`X 9jN` LjH< cj uj jH j  a>ajj* kL* k  *k`3D Pk  WkM < ]k < axgkT  ykdX  aPk@ 4 kb<m@!m* 0 n  n] -n  tĂ ht!zt,7P t̸  t4 < 0bt t8h td tp D uTT u $ u̿  (u`` 6u0 Pu u؛| u  uF0 uxFl ux u(X vc "v, Mv\ dv' P vvpx v> ve v< v !vė$" w` wh .wx T Qw$  jwD0  L ybn$*      Ȅ  ׄ H \& H <c WTD kTJt y 4x| ,   L 0\ 8Z  !T]3@Y P < \_P qP$0 "P s( ņ` ֆ@b  !\ G  h  ' 2,!H L T   gL Zbp Zp  hH " T 0  &G Y d n  [ ` x :@  s (# 6 H b D\ !b[` $ X d É<D!b$ԉ* H ( bT  2  , W4/  | q   Ҋ| h cc X T . E !T  ^ 4 l8 x h  PD lA ҋx h <  1L G , nHz x 8#L όD!L, &l < ( &; <aD M d ` D lx ~l P, ƍ ` <| p,  d -g /M  <[ | K8`!]0 ~ 8< $!l  ǎ ؎dq  ̭0!j8 @kL e\ zj  ÏL @fT (!,  ćX . P a  u<   {  Jp  >$ ؐpm ! l4 <  H$D hd$ c|`  $ Ñ$H ܑ l !  .0  C̤x ` qdt ` X8 <>0 ,c0Ӓ !H | p,!8c. Mb ~:  pD 8 $ ӓhA O4 F, 0 4 FP, w x ,* 4  Di p  l8 8 |3p (I YDc:x/< M8 _P@  !+ T  ӕ|   $4 Df  Pc , h@ 8C IA\cpQ  bYwD!H!( p , Ŗ,  ֖p L L hc_0 0 4 D ,!_Pb4 4 .tc p З  tC@ >c0l gT T~ )h GbP c(T@  g;  s `B '  ͘(  t Hx !H4 S< " 4` Zp   X]p ԙ40  ` ! d TP t 1L PG cD` |Ql  0h š0 h) [D -;T LzT d  {L Ic mI:   ؛X> x` c`  t :ܣd U(  `H  jT $   (| x Ŝ\ ,$  h  .  O  W0` zp  Y < c ֝. d t X cP=  S<H k  |xX  \ L ic̚\ <ؘ ڞ2  sc   c c.4G HL | [, dj  p !0 TP  P  џ !cU  `< H! `X Id6^( O < g0/ z | x8  <  dӠ  d (dDtz  * 0 3 p `L p0k T ~ h y l ɡ| \ ( \, 04: F [0 D D0  Ţ  ٢T ! !,  8, 4dMR a$< | !X dz  M0 أ G t  |@d4@p bl  o  3LdD!w ¤X դG ,)  (J &!= h  {X @)8 PX=4 ͥ  4 |`! xH - P8^ g!{ x=  Ӧ jXd" dd  " ,  pd*@7  C(L eX . \ | ҧt 0 dtɩXo  n  L" \t , < ܙ` 2  Sx< y|@ }d  Ū  ' 1Գ!ET dYL  b+ L d!_  @ $<, ЫT ( D DJ !'xG8 B U84 n%  {( qd<T ǬtHL ׬o  =, ~  D50 d0$|J 1ԑt D !Z8  sl < 8   < ֭" f $ { *ć  8(} dl^L\ {D  x ήb@ \  T %8l< *d44G( dLt4 k@  8 F0 4  ( ķ L gw x l  4}   ڰLT  T  4 TQH h, D \  !У ʱX x P !  +  9t+ @ _  xgL  d  Ѳ h @8 |  ! h  5* I ]X {, L i ճ D x  h (d ," Hh Y  f  } x  L\ Ĵ  d ӴHe|ڴD      f HT WX08 h    Um e,sP е$ P !2et,  F$e'`Q( 5 $ K k0P l    Ӷ @   /h{ R4 \  kp/0eL}" 4 @H\ P h ڷP( D  S| 10 CUt a  z 8G X  h5p 9Df D /( Q` d8$ {\l d p p  X=( P* 0   H t \8  ~| d $ d= GPf !P%  " \f#8p8 $hf|@L Wz g8 y3P  d  | /  )d & J G ZX r8  (  !/ ! ( (H 0 @ " 6  DHp Ux i  r  49    tf]  $D X.l  !4 F` blD 8" D ( fܲ kEft0 h   Ph P&  G f` i  \ *C [< 0 uD  p J(  H M  4+ @ 2 4 @^N  ]| n@+  ~h TX  uf- P f\A Py~ $(, 0 4 8 <& @* D5 HG LL PN Tl Xx \z ` d h l p t x | -Cg뛎-PƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ$  --0-@gD-0 0SHz0@-LP0S@@0 R 0000 R000;-0S 0Sf-- MXi@-@ P 0  @-RM@ l!2@P#Ѝ`@-M(( 0@ Ѝ@茏Lhp@-X`MT0P \ Ѝp@$9  m 0@-P0 JK0 EK0 @K0 ;K0 6K 0j00S P  0Vጦ0&L@ᵥ LTP0(\z h04x8 <@pD;\PA-Mp@ P P1P!`@rP @T. T ЍX  0p {oPPnM> hP~ ݤ0c9X 8000  BR 8 ok8 ;`@-@ӕ8 00CS0@' kG-TM@`#0DSpP l3TЍT#T3 PT  {oP0SLmmmmnnooT  'w7o w0T  w wT@00 @@ @,@ Ÿ`@P8 0 (PP<@@@D@zPP Ŏ ${PP ~UP~PU T90`@0  ,0<@@@cT !80(ێPU uO000lPU UP<@j0P 008T 80 P$P(PPPᬎmk(0 \긜;8̜8lj0@-4PM 0$ @ Ѝ0@裍<tlG-(p`P@p PP $P xݭl٭`խP0 P00  000  000'dԜp@-P`j0@ 00 > >pA-0MP\0塭 @pᷢ(P`> ܢ00CS03$P,00CS0$00CS000CS000CS0 00CS0Ѝiiiii0$0iဣ mܜG-M@pP 00Ѝz` P)m &> J(qP  p00CS0iH  R RR00000G-MP@P 00Ѝ5p ` = (+P@  )00CS0qi mP0SS0000E-M@Pp` @m =l =á( PU 00CS00S 00Ѝ)i꺢 lP00@-@$P0$0@Q0@-@P 00S0 $04S 0$0$0S $@Tvp@-MPP@ ` 0  qЍp=0S  ul0`S 00 00 7@ 0\D D08 80 ġ<; d@-\\ 0M@\@@ 0Ѝ Ѝ@蜋 $0v(O-頥 MP iF?(PpJh0 009T?\0PPPXP`PdPhPQQǫ000Rྫ0 00 "lPxP|PPPP APPPPPQQQQQ QQ h0|00PQ 0LP  A@R 0tRxR 0|R4 @R 4`0S0S 0 `0PS0S3@ 0@0 @0 @hh0 @PP0 @880 @  0 @0 @0 @0 @0 @0 @0 @x 0LP`T X2P@ @ Q P  0MὬḎ1!`@1 0`3k!0 `!0 !0P @  q0@d 0 V } Ѝ4[q8X 0 `(`  P `$`,`0`4`Bq>qhĹLY$<л0h8 `8P4hpH4_ ,ȓK@T   P p P }Pr QU p0 1P @]0S`PW 1SPK@@00CS0eA00CS0\P 00CS0RB00CS0IP 00CS0?01P 00CS03xP,!Q P00CS0P01U @TPo> Ѝkeİ1S0x0\eZeXeVeTeRewioB^E-1xMP@`p \P DD! 0Ѝ$1 NPP  0R   0`V)  00`S P P`0S0000S000~ 00 0TT0 0Ş8`d`[48l|G-1lMP@` PPp 88! 0᜞Ѝ0S7 ,P0 0PU  ` 0S 0S000P0 S000pPP0 0p^440 0Y40l,SO-p$M@ P<P] ; @ @3M 0S Q$Ѝ` 0`S+ 0S000MU8X 0  00@ H0U ` $04(  ,0 0P( U@^O @0P00 0 `0`S 0@ 0XX4O-p$M@ PPl ; @ @L 0S Q$Ѝ` ` TPC @@!0S6 0P0M 0 `0`S$ 8 0  00@ H0U ` $04(  ,0 0P( U@N H0$0( 0S000T0@ 0xV4$K-P PMR `p @T01  0 V@PЍc@Tk`O-鄡hMR   0 R XL10H1 P`UA  pV0 @0 p p+0`Q0 X0 0 PM X  A00CS0  X0 ShЍb 0 20pbP ShO-4P M 0@LP` b0p00 %U 0S"T@00CS0Ѝ 0S 0S P x2 P:h2  pb ; @ @vK 0S Q 1 0a@`PT 0 ` 0 `0M P@:0 $PS0000S000 0  0S   000b$0 ʠ$u 0 0R 0000mhhp0U 0SX0 TTT0 0@W,0(Rh4,_@-@ 0K@-dP   0\ 000,0  0 (0$ N@-@ 0K@0D-dP@P  00 $ 0 (@0 0P00@0N-@Q  Q(0 (0sSMpD-鐠Q@`P  0S Q  (0 sSpD荧p ㈧ 0S  0M4 @-0@PK0S @p@-,0MP` PЍp004 0,0R& 0S0000S000$0S 00@0T 0 TP00( 0ɠ4 R 0 @0CS0T 040O-,8MPp0 @`  jV. 0 , 0  00!`0 P4@T 100 00-@TY 00CS0  ,0 B  0,0!8Ѝ 0S 0S P 1 PW1  `,0W0,0 0 000`, 0 , 00CS04t0P  0 p p0 pW 0apt`Jh00CS0 G-ȠM PpU`#0A( 0P 0d  DD @ 0@WЍkjH \0 O-M  R 0   ЍY5 0PD 0@`p AcP0 10S e_t dPEY0p0`^00 (0 @ P(PU1`P 0!@0,0PP00 0 -_U 0-80d@  dP0 x00 0x0 00 @  08 PPn 6@ c   0_ PP\ $@ d8 ݘ%` zGGhX@-@@O-4@0 pʢ P c000Vh0`0S00V 0S ( 00$ 00 0 $0 ( d  @3H .( $0```$_pD,SD-@,M` PB@^$ @p1 @G@T& V PP P` P  0sS@@V 6P G ;3P,Ѝ`P 3 '3C0D-頠PM %1@X \0RMPd Ѝ0@0 @ဘ,,  0忙A O-LM 0PPp \  RX D0 80d`\0d0sgP@d`  R00S  X00Q00 S `,0#10X00Sw0 0CV0p X  000L GPD[: ,0#10X00S#!X00R00S  X0S Ѝẗ@ 0 @ 0 DYP s GHPD D0d`dt2S 0d`VPt@ 0 z@ 0 ye 0` SJ1 R0AZ000fP@ X00X0@0 X00CX000CS0"f] R 0000@`&^ A(4,SO-@弡1M \pPW RL X0SI \0X0 0 X0`0CSX0 P2  R00V00S$V UЍ yU  0/ U P]P U\`ᮑ` `PU PX0]PU<0D-尠M !0Q0 0 S000Q1PST0QP  <0<@  0@嘪Ѝ000:L\`t0m0@-P0SY0@00$00O-`TM@R  0P Ed00 00吐@d$ @ (,00, fP0%P6PpW(@X00X00( X0PP0CX02P@ ( 00CS0&@T 0Y  $\  $ 0  , 0a c, i Q d զʖߍ<\X0S UD \00U00S6U$ 1@0T1 (00CS0@T R  0Y $\  d i\1!000CR@0 -PP 0lPPv000  R$0QL p 02X@[O WPP @G8PEu $1S11@D PEu 10[(04 A1q8 40/80 Cr8  411!Aq0@D00800CS0[< |0PP $ <0Spl 500CS07r[5$P*A@p90@- 0@Pᘔ0 (G-0P0'M`@0p S ! 0S' [0 zP00CS0Ѝ 0S 0S P p1 P`1  `[0pS 0S 000 00P0CS0@ T00CS0@ TZdd {X0PS P W00U00S0d0 [0 P[P3hpD-lP` #U U ZH @0 gpD  pD胔 1@-0PpS `P0@00 [0P0CS0U “Z@-0pSx0 P`ҝ0@00 }0`0CS0V ZZp@-0`\P 0p謝0@00 0P0CS0U0t2Zp@-$M` P6P@ $Ѝp 0QbP00CS$ 00CS0@0;Pl` ^@00CS0Y Y \@p@- M` @PP Ѝp 0 bPP 0S   \P00CS0Yp@-MP @ť`V  ЍpZ `00CS0ʧY@-M@P  0p=`V 0 Ѝ`=G-逡PM@`P pL RQOI P Z0S5 ,Pp. 0 00 0Pp Ѝ1,0P00Z0 @00CS0101=YHH0 0p(Oc ,,S0`pD-0MSP ` *Ѝpt0@ 000`0CS0V ?T00CS0XX,+@-0M@ Y Ѝ pD-1ࠟ@S`P 0S11(!0Q00 U !0S pD辞0CS0Y0 00X!p ʓ*xp@-M` P@8 \@ 8.@Ѝp--Ѝ0@-0dPd0@dP0\0Q\000P00Q00R00\00p@-R@MP 90Ѝp 4[`P 0b_0S 1-Zᘑ06-Z጑p@-R@MP 0Ѝp [`P 02_0S f-Zh0-Z\p@-R(MP@ (Ѝp ZP -,Z` ^P @-vZ0-@pNT-`ZDp@-R@`M Ѝp ZPP 0P-@---@0-"S S'Z½- J@-R@pM` H0Ѝ CZPU 0;ZPP00P -0p@-R MP@  Ѝp 0f_P`0S> S3 S S S Z p r@ *^w] 0RQR p[@ 0Z-Y 0QQ aZ@N0@-R@M Ѝ0 XPPW$0@-R@M Ѝ0 YPPPY p@-R MP@  Ѝp 0^P`0S S  pY 0 @-0ᱮP\r9ZAA-M`PU 0 Ѝ @cZ0pS Zᨏ0d]  \0@ 00FZ00CS07VA-M`PU 0 Ѝ躏 @P[0pS Zo0+]@ w\0@ 003[00CS0UpD-4R-P  ½p1@/ A3`1`1c11@c!0"b2cB3c0Ad0cS11C11$1 A`Q 0@0t0 @@ U@01! @FAtT$0A0$1> h$[p@--R(MP@ ~(Ѝ½p 0]P`0S S  gX0 Aca-aAa@-0ᡭP [Ẏ m rq@YAp@-RPM`@  Ѝp =YP0 (@@@.~^A$$[E-Ԡ p`UP R0r:S RjV@t h  H EG(0R:SP ,SD-hh0p P`@T L0  T@(hD-0匠`SpP  0S 0SU@ PP00@ ^0@-@P3U000D-0圠`Sp ʈ 0S P0WKUp@p pP@^O-Ġİ 0MR"  U0@`jTpP*ᒿ0@T0:0g0C 0 Q  0S 0p 0Ѝ D-`DpP `;@ PPW0@ 0C-0@PTp0@<SpTW` @T00@T` )00O-逯M`Rp ,`#X/X?X 0 @IPX@T T ЍW? 0Gd0405D0( 00 `PT(T80S{ T 0P 0  Pn @0A8S񏐿6R20 REPPuD0 P`PP D0 uP0bPPUAQ(0 % _0 0̠ 00P`000 P0 T0S0AV }4%X4"UU 0RS SHX4H<@  P0s s D@S @ 0D@4;PPuPPPu U eм00QPPuT D0 uP0`PPUʪR( @P傗vS0bS* P0`V,0`0,0,, 01 0  P0V00̠  0.`P00 P0 0/> vP0`V,0`0,0,, 01 0  P0VD0 0bQPP0 RrPPu9 uD@. 0`SOHRPP( `V@400 { &PP`@V  0 0̠ 00P`000". D@bPPD0 0`S( 40 0L 0 R"PPuQ D0 uP0aPPUQ 0( P@ЖR0hS( P0Qx8,0 2,0, , B20  P0Q00̠  0|`P00 P0 0?MP0Q7, 0B",0, , 0  P0QD0 0`PPPOMK4b`\@ Ҽ<<7 DN  0嘋PPuPPPu D@ 0`U W6 01 `0DR TD 0Sk T0P0   P^ @0B8S񏐵{65/ox~00S;PPu7 uPPP00ASaS0) BSbS 0? 0/> ! T0SD@ P@DTi P0D`D ($Q( T8 0S T0P0   [P PPU   @R0  0  T0 R O,@0B8Sc6|T\{zwvutq00aRD ppPP00uD@000PP@ uD@D@PPPT 88 P08 8D08P  c3$80P1q( $$ 8R 1qPPPu$  (0aUe( 8 s00D 0 &QPPuD@PP@ uD@D@PPP08/> 0,0|1UP@PBR@a ,Q  ,0,1S, 0S1  80,PP80,R 8  0BS , ?>00c0cR#, ,008 P!*0 S C800:?>0, 0c0c# qXXX0  0Aۉ t`Hx,S C 0C 0ENP0 0C 0a U QXT H D $00lLdp0D-造RP R B_'xP@ 04 } 00D0D-p BRM \00  ?JP Ѝp00!hpD-RMP #B0@ 00ፒ0`0CS0V Ѝp00CS0mFjF 00O-鸫RMPp` +; 0 @@P- 0 S||/37Yk0ES: 0ߍJn 0PU 0SI^  JP 0S0"1 00 P @T L 0PS9ɟ 9 0@P 9uF@ 0P9 [0ES U Q IVF09 ᬷ U YP@ ~00CS0эʒEU AoU U UH8@ V?DPh1: S@@VFdU7@ V?1Ph1: S@@UE 㒿L720ESUUU0 0\P& P  ~U/00CS0* P\ P `V PU 6Ɵ@  0 @@ 9EPE` 5YP@ 0P0CS0+U  R LP60~E @T \ Ɵ6  0~xEuE@D R 5hE %5 0@@2P0S00h5\P tPj@T 4 0o~x6E@4nU 4j4@ 0QPf  zbU% :[UQ $@ ἿPN (ˇ}᛻\EU4;]PN9U3@ V?P@p1P@@UyNXP :P5-U Ub[PP  P@ t}00CS0D@T o2 0PjD@ U R0ESU P`I<}D2 R R  222U0 P@I?H}U@PW  R 010@ID U0U(U U0 YP@m ZU 0_\qU  00Q`*t ,000 0x>@4,SR@-@ 0 yAvwO-x|M p@P! !TP(4# T 07 0|Ѝ`V 40, 0(@ @&4PU (PU |(@T P? 4 0S00S` p``P@ 4 (0sSPPQKXD P=@    P@4 0(R00S v`P@ (0sSPPQ ܲP 40`P P@  ؀@ᾲP 80R  0 F4p `wP@ 4 (0sSPPQ ៲P ᰀ@  $ h ^P@4P0 X<0bV3 ` H 0 @V P ' 3#0 0 0(sSPPQ fP w@$ h$0So00CS0U !P@4P0 X0S O ` P@ 2"` (0sSPPQ ,P =@dP 00CS0 P@ 0S 0S P 0PJ00@<    0S 0S P 0P1 00@<  40`P@ X4 0sSPP@   PJ<@ 4P 0( U00S 0`P02S ``(,P@4P0 XT (0sSPP (``,P@<<`? hD-TR@  @00t<D-|R@  R  \00 P AP t;ꄴ G-鬡 M @PpT`P T x1 0 ЍPUN 0:SD U $P& =P  00 :P qt0sS@@U YP j~  ^P 00X~  L0:S0:S ;P D-tR@  0b.P 4~'t +~t,0D-$RM@P > R  10;Ѝ0 E>PQd "R 0S  R R 00it0; R "sd R0dP=꠱,SD-鄠R@  0T මP }s$}sdD-h BR@ P Q D}:00 pD-鬠RP ` R  00p`V d0S 0p @ 0 [sp:`P O-Md弡$\` (@ P 0 0[Xp 'P 8} ,PU @`Y, X lP& P ־P @0[(0sSppX P  }  ὾PЍ ,P @0[|  lR@- @0 螴rD-`R@  000 ืP |rl,O-頢,M @pPT@# T d2 0,ЍPU @  0 @ "@Tw >PTp  @T P<  `%P@"  0sS``Q MP PjP Y 8@ K H  P@>rC|@!P ljP 0`P@ P^jP Y 8@   |@]!P EjP oO9Pr 0D-頠 BR@P P Q0qP 00CS0 0 008 0004D-LR@  0 {q舨$D-\R@  0,,0 ෶P q(HO-ȣ,M @`PpT@p# T 3 0㵿,ЍPU @ 0 @ @T +pPpT  d R 00#00 @T Pd   P P00S  0sS@@QJWC 7@   2 P 0' R00S "qۼP P00S 0sS@@Q P 0P żP{   z@P 0P P00S W S7@    z@ 0' R00S P P00S z 0S   0Z(7P+긧 G-RMp@ 5 R  00ǾЍ 7 0= P@60`PT 07U@  } }0PUjp 0 0У(4WO-`R M `Rp64  00 20 0  0 P.@TV` `@0!00̠0 S@P00CS04U( p0 SV 00CS0 0 P@  Ѝ0KPk AH  p6V 00CS06 0S 0SP 0P @00 6PP 0` 0 @_6 00괢h<0D-霠RP R  B0P@ o00CS00L60  00ɽDXO-2M 0 0P@R 0 +Ph   0+ P^ 0` P :p 0 P4 0  B0P+Q40Q1 0R  0 P0A  00CS0  0 P0`VЍ00CS05500CS0ڕ50@0050 ꔟO-@``V MpP 1 0 P-  B 0ᛮP%\,0\) 0S  0 P0 A  00CS0`V Ѝr500CS0h500CS0050@00Z5\G-XRMPp`  810ҼЍ 4 P@ 0;P@0 S 0S)U UT Y 00CS05qnE @ 0@" @ 0R _ c5h0R@-B@Hn0D-lRM@  T00kЍ0  PP.8+nTE-(RMP@   10JЍ` p 0P 0 BᯭP0 S B 0᤭P 0\C ^\ 0S  0PP n"mԙG-TRM@pP  410Ѝ ``"8P 0S4@D T0P ^`P !P0 !00`^ m V000! ^ nꐘO-ԡRMp`P  10Ѝ  P@  0 BP@ 0 BP@ R RQ  R 0m4 0S0A0R0b0S#WG@ 0@P@ [ 00CS03m 04 $O-p`l< p0M W @0h |  < 84 , 0 $ ( @PGUH+;x 00 0 P9x0S<>@BDFG40PU,\ 0S[ 00CS0 mЍ =3@Q Q0p l0 >P@ [ 00CS0 ڐ0S3[ p h0  B 0@0CS0Tp0h 0CR h0Rh@@0\\pD< R ` 6P@4@ 0,Q00Sx ` 0 Rh0ppCS* 0S'|0 0l 0?P @P<\ XarPP  D`V<pxP0S 0S 40S $ X%,\ x50P@X k0SU#05 0PUx5 x Rl0 K280Sp8\ 3P D3 T 5P@3` T0R ``V` L /5P@! J`0Sڌ4QhPp0U| l0 `'0@S@Q< R QYnH2d H0R= 00S V``Vp0PUT4\+ X ,Ql0A $Rl0 @, R D50@`X0<5 :0`V15 xP#(0S DHP``DP D0c2T V5P@T `0R``$\ 00CS0 рL 4P@``$Qq 00CS0lrP D( ۦ`w+2 0 gP`i00CS0$ R 00CS0ڐ0S)ڌ&g1d1$0S 0$0CS0ڐ0S T1$d2DZX (4R B11Q0(0 S  gP [ 00CS0 ѽ < 080<@ @ 00SI0GU:P t0P( R  R00 # @Tt0  01P0@T0Sʜ  ~s[ 00CS0 0[ 00CS08 0Zp 1(00h 0 e0<0b@_[ 00CS00GU 1P P000I1F0SdS& 0 , 8<0 0 @GD\a`@XD-RM@pP  00Ѝ <P` T! 1 D0P@ 0̠ ̯0`0CS0V iB0 0YꔈpO-̥RTM`p eڰ5B  P@8 04@DL`P$lşl5 ,0 0 0舶P,0 S (*+./4@ T40S 1$ 0P@P&$0S#ڃP$T0 p @T 00p 001  0P0@S S40S D0SPTЍ@H<00CS00<0/|/0pS) \ T 0S @The@12482 T 0S @T 0S T e@12482 @TT @T/@+/0P00 P 00CS0 0SD0S@@/=/ / <@>0HT 10@0040.D0Sʜ! 0h@00000D0S70HT1 1D (0PD\@ \H0@0 D@P U (0 @01PD0PU@D0Sʠ |@m @g0\0 8 000 800N{|\a(`C-xM`p x0PPUx 0ZV `0 PS x@x P1Ux x0Px0Sx 1Vxx@Px PU@ZxЍPA-@Pp- Q* *P`PTUT000 PP`PTU0@`00@0`00@E- 0弢` 4MS@  4Ѝ3 0pS * @XPUPU Q 0S00c0..PUg UN U5 P  @p @ 0 B  0 0rP@  Xxg |1P Ah  g0 0$ 0P 0P 0000 1P  Pw, 1P0 ,0RPŊSPU Q  }>.:.P0C-`@MPl00 ? 00 p9 0V ]000 `pG0T Q000 @pYpWpfB`P00  @00 Ѝ@00 W T9 V7 ፘ 0P 3@H$H , xTY `@ វP  'P`@ ᏜP P`@}Tf G-0 ,MSpP ,ЍX P`30At00@ 0P `V 0PXx ᡿\ TT0P 0`f0 0_-z`dp,SRp@-`@ 0 3 pPU e00CS0 ,O-lpP`M U 0 D  8 4 ($ ) & f 1P~ 0-S 0 0L@@P0L0 S 13569<?AC^0PU4@e0lTT`` V 4 R ( bP bP`Ѝ0S 00CS0 +,  p0 S D04 00CS0D0S4 D ( hbP D$0pDQ0[$0,0 W , Q@$0  ,0bP@ P?@A[,pWPg0ES P4V4 nH0 㩣00CS0H0S H , R4@ H0S4 @40P 0S &S \S  0S &S \SR00S40@B  8`P 9 40P2 @n4 0P& <n000H(0@0PR 0P0ڀ0S S$ R0 8 g`P000L< (Q T`X0H $ :p`<0僀(0 V0(0@ &PpP \PP 0U@V  f pYzH @0Rp H , R H@0P(0S[4000 R8. McQ 40 0R Q 40 0S Q 00CS00dЍ)00CS0)00CS0)40 809P@4  R ll580@c 0 N* (-8H0@ S co oH H0$ QH @0R0H0~ oH P0 0 @8 Sp&P\PW f@4  0vo`\0 P0 GV  f hoT0WX0!0 SR 04\SP`.H cPo lH 0R00 Do))Y4 @P \ԺPp( @3DWm4@@Rm4 <MmD @0R00C0R00[:000 l000< o  o([(0#:@00 ` P [*0 4P W [:( R @000e0̖  RD R  P(0S U e nD0< Pn(E(  0P P冭P^񏐑"8s06pF0D S @pDW$  'PU ׸P0@0  θP0S pa*PpW0`@S  P @QL=  Qs <  QZ c'D_'@ 0,?< H<`^/ P U@ @RR@R00D  P0S Š0Ťcʤ^ P) _ЍPR'RP\D @Q $; ; 0S~jDzj@ R X; P; 0SD :P:  0㬭d:  0_0DSI00堰Ajp =jT' Rڠ0P00C`X * 0$4R PU:00T00S0 n /P0hð 0 ڞP0\\PlPʔ09T9) 0S i  @0 幞PQ=0Q:i@ ᰐi* D 0 B ᛞPlP0PD 0DS0<80407  08'70 0 PPT* 0pDS 0$  &PU3t XP 4  X OP$00S0000S 01@% DR D0`S3KL[[\60<0< R D0S*D RB40͕ ͕%< P8 D 0 RD :080\0Q00S M(̠00 hP 8}D65D R*D0\D:8X5T5P5  Q @5 Q 45 Q (5 Q P 0PPgsP8P4 0<0D0D c4 =(P @ 0D 80"S 0DSD b D0T4j8D4d@4b<4`84 /$P R Rt0Sq 8 n0S 3HP )Pa ȵ00@ |D80K0"S |0D SDax3,D R+*D0@T &00  DQD:84Q1 3  020DSY0x0堰Qh MhT0p0 @C\&T$:0 `4X0 4%S @DT* P0gð x0 Px0S S00C@0T1^ ! 0S gZ:$0D S( , $ T q@P! 0S Pt l0 Pt@Tx n 0S c  g0`SJ( R $0S& 00CS0 #lc`b$HX,Ttb(<tl@@p, @ 0L\p|h,!0HPTw T;C; D!0UD`% P P!* RB4p0͕ ͕V @TP!* RB40͕ ͕F @8#8"SD 0 gD PU:H0S D PUD D^ PRB4p0͕ ͕ @TDP%* RB40͕ ͕ @8#8"S0gD UVRpMHp  0PH0|PHxT = D型  @@0 ۘP^࠱^`UD,0DPpP`* RB4@0͕ ͕ P MP T`:V`@T` Da `@@0  ᝘PnP^ࠡ`^DP@U RB40͕ ͕ P D寋PU@ZUP ?0EO-PB@TMp` 0԰ 00  0˥P 0S S d)@TT d0 0æЍ (/P XS8Dc\O-HpD9 `0hMPV@(PP 0$pP /00P 4 P Q0dSPP, @R d30S+ @0P( P̠, 0P (P T (02P0S @ 0 0 [0X0 WP01 R ||2 0@7W  WD )WXz P0`Vv1P 0#S P0`Vj!1  0 W\L0P 3PP@TLpZʈ1 $ 0ᤤy h V?X L1  0㒤4 R  1 0PV# 0P@04 0P@`V!080(   P@`V8,P@`P@r0C\c\h,S(Tt4L*`LD-xR$MP0` 0 R  L10*$Ѝ 4 P@pP T@D 8PT@D 0 , c0!0a10Sڐ1A- |_l_\_0 0USqӭꀄ.A`98H\XD-ȠRM`P   00ȣЍ p uP@0S PP@ P T@T V i7dtE-@唤pTM ` T TЍ0  P /T 02@T 040SU 0Sd 0SOS"LPP 0S R000 PL  P0cP 0 00 S|9LPLPP 0S!S00 @ 0#80 "$ 00'RL R0 cR 00 SQ9LPLPP0U  W000(RLP R ?9LP0S/SLPP 0S T000 (9LPLPP 0SU00 @ 0#80 "$ 00( 9LPLPP0U  V00(8LP 0uPp LPP 0S0  p 0L0R< R gR 0 040 S8LPLPP 0S0@@ '''Ġp8 L P PgP 00 S8LP%6xD-0匠@S  L P0R A00\0L  &R R R 0 00 S8L D2xO-@ 0A$MS` Q 0S 0Q 2p 02 PR $Ѝ,P  080S 0 0R 008LPP 0Sk  E00@0)))Ġ&0L0R R iR M0 00S. 0P3h LPP剁LpG0i!U@ 00 LP R R R 0 0h iL 0C!LP0` 0q {1 P0U 0 l00(*LPR R R 0 0LPP 0S _00p000 0 Ȝ L \P \\ LP 0 0XP 0S}  0 L P PaP f0 0{LP? LPP0UY 00 LPP R R R G0 0[LPP 0S  0 L P PkP 0 0LPP0U 00 LPPP PP LP0 0P0U 0 00P LPR R R 0 0L 0PpLPP 0S 0p  L P PgP t0 0p 8h0LA  i1| LP { P0UV l00 LP( P PP DLP0 0P0U: 0 G00&LPR R R (0 0XLPP 0S  0 L P PaP 0 0LPP0U 00 LPP R R R 0 0{LP, [LPP 0S 0 L P PkP q0 0LPP0Ug 0 00PLPP PP ULP0 0P0UK H00 LP&R R R 90 00L L c07P#LPP0U F00 LP&R R R  0 00 p0C 00 ST6LPLA0Xc"0 SB6LP0 S96LP0 S06LPtLPP 0S 000@+++Ġ!0L0Rn R kR 0f0 S6LP0 S;5LP*0 S5LP LPP 0S 000@(0((Ġ!0L0R R hR 00 S5LP0 S5LP0 S5LP0 S5LPqLPP 0S 000 @'''Ġp8 0L0Rk R gR 0c0 S5LP0 S45LP#0 Sx5LP0 So5LPLPP 0S 000@+++Ġ!0L0R R kR 00 SG5LP0 S>5LP0 S55LP}P 0S 000p@'0''Ġp!0L0Ry R gR 0q0 S 5LP0 SF5LP*0 S4LP 0 S4LP! h0L L@iA0 02hL0  CLP@0 c 0 S4LP 02 @Rf#)Pa  0k4k1xD-0匠@S  L P0R B00\0L  8&R R R 0 00 S4L t"xO-TM\ 0@L @2pQ ߍP`U U U  U U ࢨP0X  SPPU 02 b@ 0Q200p (P   03pW  0l/ @T/  0  `/L`P 0S  s000@(((Ġ*0RL0 R hR 0 00 S 4L` 0xPP L`P 0S 0 P  L P PeP 0 00 S 3L`L`P 0S0@ @%%%ĠP8 L P Pe 3L`0  1PP!L`P 0S+0   P 0L0Rk R eR 0 0c0 S 3L`L`P 0Sp;%%00p @%ĠP8 L PA PeP 00 S h3L` P7 R0X0S40 0/ 2 B< QP`@'P  002@0<4 0<82 Rx p) P, 08 x2q pR `@|'P  02,0  0!x 0<2\xp0S 0w8 0x2x< Q90xP8@Tv  0.x <0 Rx L`P 0Sb O00<+L`0 S 5+L`0 Su ,+L`d0 SY #+L`H0 S% +L` 0 S +L`0 S +L`0 S *L`s0 Sh *L`K0 S? *L`.0 S# *L`0 S *L`0 S *L`0 S *L`q X0 ?PP!L`P 0Sl0  P 0L0RS R eR 0 0K0 S *L`L`P 0S&0% @@% %ĠP8 L P* PeP 00 S w*L`\ ஞPX  `0ASPPU` Q"@ 02p 0SP@P  0)@TH  0w%L`P 0S8q00 0 @0#80 "$ 00*LR R0 cR 0 0L`P 0S  (<0(8(0L *L`0 S )L`  0uPP"L`P 0SD4 00 P0 L0R R eR 0 00 S )L`L`P 0S0%@@ %%ĠP8 L Pz PeP 00 S )L` 02 0R )BO0 00 qP00CS0U2  PXT 02 Q"pP@P  0)0Px@T5  0$x 0"PxpL`P 0So000 0C#<000C#80 @ B"$ 00C0p*L@R R0 c *)L` 0PP L`P 0S 0 P  L P PeP 0 00 S )L`L`P 0S0@ @%%%ĠP8 L P Pe (L`ꌷx-0Q A  &O-0$@MS`P p @Ѝ0 2@ "0S 02  2R,0S0 0R 00) )0 &LP0[L @0 0PLQ QQ 90 00  n) 0 LP N10h0 @aA0,0 0\&h L0LL@P 0a[ 0 (  00 LPQ QQ 0 0 h0!LP N@`A0 p 0 )&h L 0CL@P 0a[ 0$ 00 LPQ QQ 0 0L B40 pc 0`)P 0 0( $00 p "&L0L(L`Y P 0S| %000i@P! 0!Ƞ!0L0Q QQ ^0 00 L@N lh0l1($  p05PP$LP 0S 0P  L Q QeQ 0 000C00 S 'LLP 0S 000%@%0%ĠP80L0w'L0 S n'L~P 0S  i $00h L ['L0 S =R'L,0 S I'L0 S @'LxO- 夫 WMN?LRID $0H (0  H R0HBS P 0PU208S Wߍ0B?0S0000Y 0$ 0 1 1Y 0Y P P?0@cTg 0 P2U0 0Q,<0GD 0&0@30 <@Y@9 @q'0 0R 00p  4' H0 PY4ɟ 00U00S 0 P2 UL`P 0S{ C000'L'X0'@PpP&0L0R R gR ^0 040L`h PLL c0!SJ D000 @Pph&0L0R R gR 00 0S  K'4h0L B @l8A0  0L>$h L 0CL`@P (0aV 0  00 L`P R R R 0 04h0LL a1L`paxWP 0S #00g@P0! !Ƞ!P#0L0R R R 0 0L0  CP1  c0L'P 4h0H@ l1 pxW   g"00 g"""Ġ#00 4hL B 0l(   0EPP<L`P 0S3 0P  L P PeP 0 0 0Y P00Y$\ h f0,0C0`0 S %L`L`P 0S 000%@%0%ĠP8 0L0R R eR 00 S b%L`0 SZ Y%L`=P 0S "0g08 L PH PP 0@0 S 9%L`0 S 0%L`0 S '%L`0 S %L`<  @L 0K T;L`P 0S20  @0!RL0 R dR 0 0L`P0V 000L`P R R R 0 0@0 S $L`0 S $L`L`P 0S 000$$$Ġ@0! $L`$` qVpP  1A`ǘD 0S$V@0 1Y D 0A$0@<YY<0S*`} c} $ !0 LPx,}, R$0` qRy 1AၘP, `V,@Aᴺ$ᱺH ClxK- ⢺0 Xp0 a 0 P@⑺\@ 1 0\0 X p@-0`SP@ PU@p@޺O-p 0M Y  0 @ ` 0S 0`V2@  0 0$$@ R 0`JT  RD<P? 0`V2@ 0 S  0`V2 @ X0S  R R $ (0R0 R $0$L0  Cx0 l$P  000 0`V2@0 V 0S  RB$0S C BL0  C0 c0$P H0  &R# 'R Y 0 0 0X$V$ݍ0 8<4 < ( 0 0 04Y R 0SR+ 0S&0L`P S00PCPC0S _00 0@%%%ĠP0L0Q  QeQ  0 0R*L`P0V" 0 00!RL` R R 0 00S L`P 0Sa  0 0C#<0@  B"( 00C#40  B LQ Q0cQ 0 00SL`P0V 0 000"RL` R R 0 0Q0 SiL`0SW 0SFS!L`P 0S 00  0QL Q0cQ 00 S?L`L`P 0S00 0 @0#80 "$ 00!RL R0 cL`L`P0V 00 !L`0S1SL`P 0S  00  0L`L`P 0S00 0 @0#80 "$ 00"L`L`P0V 00 "PL`0 S9L`L`P0V `00 L`)R+ R R 0#0 SL`0 SL`0SW 0SFS!L`P 0S 00  0QL Q0cQ 00 SsL`L`P 0S 00 0 @0#80 "$ 00!RL R0 cPL`L`P0V 00 (!BL`0S1SL`P 0S  00  0@*L`L`P 0S00 0 @0#80 "$ 00X! L`L`P0V 00 p!CL`0 S,L`0SP@ P@L`P 0S! _00 0%@%0%ĠP0L0Q  QeQ  0 00 SL` 0<Pp L`P 0S 0 p  QL QgQ 0 00 SL`L`P 0S0@  @'''Ġp8 L` <xO-`,MV Ѝ@0FpT 엟 02 pRPU U P@0F T 0dS 02@pTP0-S UCL0  P`!LPP 0S00 7` PL PfP 0 00 S LPLPP 0S0@&,& t6&Ġ `8 LP[ 00 ^R000 0R$Sh  0U 0.SX `0U 0R\S 0R.SF ຊP@ ᜭX}.P 0Q00S  i0 :P`LPP 0S 0  ` 0L0Q QfQ 0 0o 02@pTA  00Q00S RLPP0U I00LPQ_ QQ 0W0 S sLPLPP 0S N  0 XL Q? Q b [LP  0P`LPP 0S 0 `  QL QfQ 0 00 S 3LPLPP 0S0@ @ &&&Ġ`8 LP0 S n LPZLPP 0Sx 00 @0&&&Ġ`80L0QT QfL LPO PiR*0  0Pڊ0 S*00 P00 RP`"LPP 0S0  ` 0L0Q QfQ 0 0凬0 S LPLPP 0S 00 @0&&&Ġ`80L0Q Qf LP0R*S0PE00 `0*S00U 0R\S PE000-S0-S@ꌭ|xtO-0吩 MS0kC @` Y4p҉P U^000A PP@ 0P U2` @0 @g3@PUJ00CS0`PUZYYTS [. @T 0RlY> 0S; l0 pPSJh 1e`A0S PU@DZW%00CS0LPP0U 0pLP R R R 0 0Ѝ0 SLP MP`bLPP 0SY 0 `  L P PfP E0 0LPP 0S:b00  @ 0#80 "$ 008)LR R0 cR 0 0LPP 0S00 0#80 "$ 00LLP0 S{LP0 SrLPLPP 0S 00 @0&&&Ġ`8 0L0R R fR 00 SKLP00s@j 0P`'LPP 0Sܴ0@ @ &&&Ġ`8 L P PfP 0 00 SLPLPP 0S<0  ` 0RL0 R fR 00 SLP  0lP`LPP 0S 00 @0&&&Ġ`8 0LPt0ᚪ 'pq0Sk RhPb 02 Y2p_ 0묲@T 0LPP0U m00@*LPLP 0 P`LPP 0S 0 `  L P PfP 0 00 SoLPLPP 0S0@ @ &&&Ġ`8 L P PfRLP 0P` LPP 0S0  ` 0L0R R fR 0 00 S)LPLPP 0S0 @ &&&Ġ`8 L Pd PfP 00 SLPx G-P0LSM `Ѝ0\pp 2@ 0GW 02@T 0X0S 0Sh 0SMS(LPP 0S0WL00 00L0 W . L0R R0 cR 0 00 SLPLPP 0S0WL00 00L0 @Wn00#800#40   L|LPLPP0U 0W L00 0W0J?> R R dLP0S-SLPP 0S 0WL00 00L0 W-z/ILPLPP 0S 0WL0000L0 @WV3LPLPP0U 0W L000W0>? LPLPP0U 0W L000W0b?#> LP 0P LPP 0S0   0L0R! R hR 0 00 SLPLPP 0S0@ @ (((Ġ8 L P PhP 00 SLPꈛxO-0D0MSp 0@ 2`K7 ) 9P 0 @WzP 00CS0 8.0Ѝ00CS0! 0"0C`SC0SH@T/  0 0[2`ZLPP0U  0L0RK0I000 0Sn>q> R R R 0 00 SALP 0Pp LPP 0S 0 p  L P PgP 0 00 SLPLPP 0S0@ @'''Ġp8 L P PgLP0S`H@T  0 0[2`ZLPP0U 0 M00@'LPLP 0NPp LPP 0S 0 p  L P PgP 0 00 SLPLPP 0S0@ @'''Ġp8 L P PgLP0SpW 0  LPP0U L00l4LP ('%wLPq^@@ | 0P@LPP 0S 003@ RL R dOLPLPP 0S0p$,$ x3$Ġ @8 6LP 0AS Q # 0S<  0V 0[2`Q LPP0U 0 I00&0 LPLPP 0S 0N  XL P PaP 00 SLP 0Pp 0P  0[Pp LPP 0S 0p  L P PgP 0 00 SLPLPP 0S 000'@'0'Ġp8 0L0R R gR 00 SLP250@00mn0P0CS00SpPWP ୃP 0 2`;xDcx|O-0FM`L @`4 2V4p @ PT00R0ST P X4 0`FV2p@`FߍT | qPX 4 TH cP00 T  XPV4 0`FQ2Pp@` 0`FV28p@`p @V J@`,T0@ 0S 0S,0p1X, 1@T 8 0`  @ #$@@ !p(垃@ X   }0008000BX t , 0  LPP 0Se _00000 0 0LP PP J0 04P3 P 4,A00Q $0" `   vLP  RLP L0 CLP0 R`P0U 00 LPPQ QQ 0 0, 0 0  1 (0S @ X,00S(P1LPP0U F00 LPPQ QQ w0 0X 0P`RLPP 0SI0 `  L Q QfQ 50 0 X 1SL  0C1 0X PJ$! B0 c06PH H\ 0P01 RZ\ $噤ᗤ 0 S LPLPP 0S 00@0&&&Ġ`80L0 LP0 S LPq$ "  L 0C  1Q0 S > LP.0 -R v   `0$ " g    3LPP 0S0N  0 L0XQ Q`Q 0 00 S M LPLPP0U I00 LPQ Q ; LP0 S 2 LP,10 RvP0(0A z0 -RK,00S,0<S D@e eD@ <0qaP rfof@P  <徣M0@IP,00 $*P@0{QP``XJ< 000 BP020 0,0VAP 0}S1`0U@%*ف@00 " с 00  PU@%@5:@0{TP``Xf 0U ,_0{@`Y<00LT|x@- 0MpS 0`P U2@0S PUЍ0  RBP0#03 )R0SP:R @P :R0P:SP00:R00S a0 02@ 0P:S O-0P8MS` P 8Ѝ0 2p  2R 0S10@$ 00z00CS0gX$0S_ P0 0R 00n ULH 0b0Dh0 @` Ab0 0  h L0LL@P 0aX 0  $0 00L @P R R R  0 0UL 0CL0aS0P 0S #00P@0l# #Ƞ#0P#RL R R e0 0LA h0 `1   0PP$LP 0S  0P  L P PeP 0 000C050 SU LLP 0S 000@%%%ĠP8 0L0R R eR 00 S- L0 S$ LvP 0S0 c"008 PL PP 0y0 S LLL,0( 0c0 0L P    0   L0LL0aS 0P 0S %00P@0l# #Ƞ#0#+ LP 0S0 c$00h L0 S L(  LH 00`xO-Pܥ(MQ$` 0  9 ^0S $ 0 R"0000S L0 [ 0P 0T0(Ѝ+2S0 0R)S 0S0 @0(S P R  0pSI 200C0  @d0$ 0l l0 R0C 0I Q Q0:S  R 0!\00Sa [00  00P00S00S0L[} Q$ 0u @0dPp L@P 0S003p PL] PgP 0 0U0 S  L@L@P 0S 00'<0x2' 'Ġp8 L@ 0!Pp L@P 0S001p PL PgP 0 00 S  L@L@P 0S 00'<0l1' 'Ġp8h L@ RL0:SHK弟0  C00000 000})00 0 {R p@  0 S)RX0(S P0[S 功  0 0`0C@0yxO-"M MⰡ LP`   p@pG0  0J,0T 0X0RJ 81T   R R R(90(0Y  X d0P`@U P@U00SPU@ 0PᒟЍۍ d0P@U($0S$T sx 0@- @00CS000 0A- 0`p00W0S8& QLP @Q 00CS0@T000XTP@00S@TPA3SLP@PQ9@Tp@-@P$ PPPP PG0].P0<0`΄U `0(0PXhx |0`HLTP\PdPlPp`tPPPp@-T0@Sd0St0S 0S0S@xޞh۞X؞H՞A-0M@Sp P`C S ЍQ@ 0`00PEu 0S* S V V 0PEu@W ?000CS0 V 00CS0V Q  /O-逫M M@L ͍@ p 84 `80T<0 ?$ @R0P, 0(@0,0;00 0( 0PBQULPLPP0U3 00LPP R R R "0 0L0  C8x0< lLP2 "$ 0"0CBR$00C$0Y0 S 0Y2@H0 Pc b08PX2 Y< B9000S 0  _0 S 2"Y@Q LPP0U f000LP)R R R t0 00iS i0i0 0L 0C8$ 0lTP@0( 0a c( (00@S^L04 S @0`0 Z` Ѝۍ QP` LPP 0S007` RL R fR 0 00 SLPLPP 0S 00&<0p7& &Ġ`8 LP0 S0 SLPuYYLPP 0S0  0 RL0w R iR 0o0 SmLPLPP 0S 000)))Ġ0 TLPLPP 0S!e00# "( 0#40  0L)R R   aR00 0S)LP P x_ _0 , 1P: \7 ,041 `1LA LPP  P 0S i000````0L0)R R R n0 0   PS H0 0L0 0RX` X0 2NY2S5 VLPP 0S0  `0 RL0 R fR 0 LPLPP 0S 000&&&Ġ`08 LP  P H L00b0` ###Ġ0w0 StLPr 0`P0U X"d000LPh)RLP R R LP0 0 0 SKLP0 SBLP*` !0 00Pk-2"00CP B@0@-D Y- ᰻ Q0 0000 SP* 㙻 㓻 ᏻ00CS0DH@0D @]  w00CS0@x@1Tnx,SO-䪟MpL `]X+ڨ:0000CSRPONLKJIHGFDCBA@?>=<;:98769 u]HXp R0PpLPP 0SI0  p 0RL0 R gR 0 0[hILPP 0S 00 LR R R r0 0K[[LPP 0Sb008 L R R kR M0 0L0 S ]Ѝ| 0᣿P@ LPP 0S0048@ RL R dR 0 00 SLPLPP 0S 00$<07$ $Ġ@8 LP0 SLP0 SLPs0 ScLPOLPP 0SF 00@0'''Ġp8 0ALP@ hR  R0 P@)LPP 0S 0  @0 RL0 R dR  0 0 \ B00 SxLPLPP 0S 000$$$Ġ@08 _LPD R0ϾP@(LPP 0S0  @0 RL0 R dR  0 0 \ P@^  \  0D0:Q (Q \r 0P RW  B 0BY>Y#LPP 0S 0 @!0RL0 R iR 0 0 0rc\0 SLPLPP 0S 00)0))ĠX!0LPLPP0U 000p!RLP R LPY)YLPP 0S 0  LPLPP 0S 00)0))Ġ!LPLPP0U 000(!LP 0P@LPP 0S0  @0 RL0T R dR 0 0L0 SZLPLPP 0S 000$$$Ġ@08 ALP 0S0Q)S  \0:S  0 S(LPLPP 0S 000$$$Ġ@08 LPbx0D-鰠R @  0 3L P0R 00p0L  R R R 0 00 SL RD'WxO-騣 MR@ ` Ypx#0K 0 Ym 0 Y2p0@CTLPP 0SZ 0 0 LR R R D0 0@DTTLPP 0S4  0@ L P PdP 0 0LPP0U 0 00 LPR R R 0 0 Ѝ0 SeLP0 S\LP0 SSLP 0ȼP LPP 0S 0   L Px PhP 0 0p0 S)LPLPP 0S 000(@(0(Ġ8 0L0RO R hR 00 SLPLB R* LpLPP H0P0L0Vx4WO-l0L M`1c 1LI\p00!0 0 h  0d 0 QPP@0 0R 0P0S 000 $0 ,0p( l0 40 <hP8 0HPH@0 Du Q0PLPX 0 1Q 0RP0P0#[T0P P  0S 0S0@P0 ЍTP tPPht8SXK-PM p0(  `P@U 0 0 W1 PU@X00[0SЍ0P0僖0 @S00 00X0? 0PP P000 tAtP@-H P0LpG@0b`TH PstT0S 0HPT0L PH屖O-ܠQ`Pp 0Q3|0VVxBxB0 W0 p `xBაx 6t0S0x|0xw OD-dQ@Pp` 0Q<|0Tx02` p,NK0C %  4 > 5 0 t 0pG$ 00CSp,0`,0@P%%<`R !$  % 0000 c 6qA 00P ,q B00C@ST D  0  H 0L07$0H0 00  ,00  00$ho$odao4do0$0 4 0000  00$0 4 00  00  4  <60 0$0@0 4 0@0 0is"otodo$dmo4odcodo$d\o40isnLodn$dEo400  00n3odn$nyNP @@PP % op doPoPU [?0n44 8 4 012c8V800 40c ba800 4JX@" @$X0<" 84X 00 X$X04 ) &$80 X0 04 40X0$ 004 Q 0S <0S 4\ 0 0R 00 dCndn$0 0} $ 4SS Q0 2"P2 % @ 5 000`S <4 Zj40P@pW  08040 aP`0  0,3IPP<0 S~*400`Sq <4 -j40PPXe 0@040 0$D 0D0@S 0 P0CS0:00CS0 80 a0P0( 0S 0S $T$0<00( 8@ 0\Ѝ 0S 0S P 0P)00P 0S 0S P 0P00pg <4I4,0S <,00CS0/PP`$x\P@ 2"p @00CS0 o\P@$ \$ً 0S 0S P 0Pˋ00@7 0S 0S P 2 Pᶋ 00p!00CS0 0S 0S P 0Pᜋ00pp <4I4L H0P L0@ , R <Q,D:(0S;D$L0`T0 HDp $0D0@S P00CS0 HL 1`V0 00 0S 0S P 0P>00P J(hO-,,B M@ ^  7PR<P 0p@0W0100,P`A @ 0 S P4[  0S0CS0 @ 80080 @ 0pPWЍ 0S 0S P 0 PҊ 00@=<00S  0`0@ 00@T  R 4400` $!h0@-@P80@0P80 @P@T0D-@,MQPp` @! 0S P0S0@ 00 p0R0 P00CS080 `080Ѝ 0S 0S P T0 PKD0  PhpD-X`T0 P @\ BP 0,P 00pDpD-0@SP` ; 0S "P0S+P,P` @00CS0Y80080p 0S 0S P T0 PD0  @L eh0D-<P8 0@ S P 000E-鰠`0 P @\ p P@.ZP0  0  008 V@ <00<0 (0sS000X 00PD-@ 吠`ppP  08 R h ZP 0V0  (0sS000W 0000|0 0s 0 0<00CS<0E-P4MQ`@p $AT; D0 PP 1 00 `0R0 @00CS0 Ѝ 0S 0S P T0 PD0  @y$h`D-P MQ`@p =T7` D0`PP  1,P` @00CS0X3Ѝ 0S 0S P T0 PὈD0  @'$C?<hpD-鄠0 @`V p0P P" PD$@0<000@P 8P@ p` hG-|`  d00n[PUp @!0 PU@ ) d,G-鈡(MQ@ `PTQ)  0 DP Q  0 P@ Q R 00@y (Ѝ>   pP 0pP_P@"0@S   ԧ Ч0  u0S 00Z0@SV 0P FP  0  0S  $ `V` 0D-dQM P P00XЍ0 &P@   pD-QMP `@ʤ00XЍp E 0P P 1 0P@P   0D-lQP  \00X0@D 0S P>V  04 G-40AMS` p 20}XЍ0 rOPPr 0 ;P0S`P6V 1 0  ̠0 EPP   P  wX 0S0C0 0 0SV 0@00  00CS0 s 0 0@0P@[P O-袟QMP ` 20WЍ 0 NPp 0S 0P [ 00CS0 0S 0S P (2 PƄ2  p0 Pm 0Sf@T 1!0 ! xP@TY  0̠0 OP ^ 0S Y 0 0CS0[ 00CS0 0S 0SP 0Pn 00py 0S 0S R 0R Z  00 0 # EW p`\hG-졟QM` P@10+WЍ0 NPpc 0S\ 0P T 00CS0 0S 0S P 01 P 1  ppP@-0P%  0 @  @@T@T0 P̠0 NP )0Sڛp@\hO-ܤQHM P@ 40VHЍ,00 &P00S tg,04  0(00 00 0 $00 0 P@9 0S63#0  0 `$ (0 `UNP $0 0CS00 `FNP@y   qsP@@ Pd0 0S 00CS0@00CS0$00CS0T   0S 0S P 2 P|2  0S 0S P 02 P 2  q 0S 0S P 1 P1  pZP@ P  P h 0@@ 0S 0S R 0R Ể$00$T%$QP'  0`$0 0CS0 0S 0S R 0R ᎂ$ 00$ 0 X<h,SdE-TQM@ Pp410fUЍ0 [LP`= 0S61 D 0P@ W 00CS0 0S 0S P 0 P=x0  `̠0 MP `pyH hE-HQMP `p(10 UЍ0 KP@: 0S3 E 0PP W 00CS0 0S 0S P 0 Px0  @N̠0 LP @p hO-鈭QTMP p`l=0TTЍ P=P-0 <@@SP<@T C:T  0U = @840P 0PP@T" 00 S40P 9BP 0  00S  88 40 xv@U < 0@84P0 0 P@T1 Z^P 00S80P AP0  00S 8 40 80 40S   )@U : 0TR, (0ၠP,0S (0`@ 0 800 40 00000 0PS 00CS0700CS000CS0 0S 0S P 9 PṀ9  # 0S 0S P D9 Pᢀ49  ` 0S 0S P 8 Pዀ8  P00 S[8(0 084@ 0 ̠TKP@ ̠40 JKP@  upPP0@00$ P00CS0$0S80 0CS040 0CS00 00S 00CS0`00CS0D00CS0(Y 00CS0 P 0S 0S 0P 6 P6   `  0S 0S P (6 P6  E 0S 0S P 5 P5  `. 0S 0S P p5 P`5  P 0S 0S R 0R 4004 ec 0S 0S R 0R ~8008 GE8 40 8 0S 0S P  0Pc00@$!00CS080 0CS040 0CS0q00CS0U00CS0900CS0 00CS0( 0S 0S P D3 P"43 0  0) 0S 0S P 2 P 2  u 0S 0S P 2 P~|2  `^ 0S 0S P 02 P~ 2  PG 0S 0S\ 1 \ ~41  400u-s 0S 0S\ l1 \ ~8P1  800TR 0S 0S P 0P~00@74 /Z$HT R  0@ C R ` 0@ u t u @\<h,SO-HQMP 0 $30;QЍ <0HPp   bP0U`00ڼ2"0 !  0P@Tz1*  K`0S00CS0S1 "nP@F  0GPp  O !P"0S,0S`@1  0GP! 0S`@̠0 HP  G0! 2p Ep 0S 0S P 0 P}0  p1 ̠0 HP00CS0N 0S 0S P  0P} 00p<9 hO-LM0Q` 060aPLЍ< VGP@ V  F 0#P@ 000,4  8 0P@$&p PU 6 @0,0 S0@4 ̠400 HPG 0  ,0S 1 -mPp2 0FP@  [( -P 00CS0  0S 0S P  0 P| 0 00PM0SVpV$ 0M$0 R( -00CS0V ̠0 GP  9P 0S 0S P  0 P| 0 00P 0 0FP00 (0 !p(0$ 0S(0( ! F 0GPp< P00CS0\ 00CS0 0S 0S P  0 PV| 0 00@ 0S 0S P  0 P?| 0 00P00CS0\9 00CS04 0S 0S P  0 P| 0 00@ 6 0S 0S P  0 P| 0 00Po@00CS0 0S 0S P  0 P{ 0 00PKdn00CS0 ne 0S 0S P  0 P{00P)P|4 h D-XR M`Pp 8"82 0@@MP0S#'+/37;?CGKOSW[_ ? Ѝ          K   I  +     00N utE-阠P @p뀀 `0R PP 0S 0S0 0P w@-0@s- @ wD-@M@ .P  @Ѝ w- @d 0wD-<M@ P  @Ѝ8 0wO-@=?h@0D-dd0d@ \0 M b 4JP P Z,JPI Ѝ0P @-M @\ 0  Ù Ѝ0@- M@PP @00$JP 0@ Ѝ00D-\Q@P  H0 ,P 00000D  P@-@ 00CS0 0S  P:y@7y.I- P  00 O-XpM ^8`0 0*0,PIP @ 0 hIP`?0 p p9 0S @ h0  \ 0S hIP `0 sS  㢘bIP IpЍ x0D-PQ WPP 4@oP00 P000 D-Р0M ` 00pS P 0U*x@$'xP W0 0 0 S  40 0 0 P pЍ0  LO-HP8M px:0Y@`CB Xp W840$0000,00(0 0$0 00P 000 00 0,0 p0@b00Qpc : 0d`C@::8Ѝp0, O-ؠ(MQ PpX@\`Pd`' [  RWL$pT0LX UPV`@D 0pL0@ `P T00(Ѝ  0 O-`@8M p90YP`CH Xp W?40$0000,00(0 0$0 00` 000 00 0,0 p0Pb00Qpc ,: 0e`CP$:0S :8Ѝ:Tp0 O-(MQ@ P`XP dp. [  R%VL$`L0X PcYT0Wp 0`L0P p0S0T 0  T00(Ѝ T 0@l @-@ y@WpO- M  Rij I=@0   p垖000 0   \  `P W!PR`V00 U00SV 0PVV \l W00PU00S1 2園`0 <0@000 0p0CS0GW <@ 12 < W00PU00S 0R0W00S00CS000CS0  00CS0 ЍLL1 00 00 %< @ 00CS0̐0 (0p0CS0tq.@ 9  =<`_0` R P`V00PU00SIX x(,SG-TM P`p5 0!01 0mP08c0@8#T D0DS*, (  &p0Y0W00S>`ЍTT0  04@ ,SO-@M= 0 72c@$@  0$S 0P$S 0$S]8[ [,@SC:uC/ S 4pKP.u  S0 PAYF (0 S  0 0 34p$ 0f 0 ` `AP` 0@ 462 B0PCU ` Q00CS0P A  1S 0 ^Q0@0/1R S^ڋ4Kt  :S 0aAp31S Pt 0 A4\0C 0PU^P Q P\0 E4P P0Uڈ2 1S!^6>bP` @!$ 0RS u70 (S2(  2,  20 < 04 80 ߍ;71bP`V.7@Q 0@4 62p `VPJ0S ,1G@ 04 6 2`VPJ0S A$1pQr 040\00k ,xR% 0S 0S P 0 PQt0 00 ỿꣿ hv\ABpDO-MY?@ 0TADA?6Q?0 0 0$0040XpU036 aPL X01P`0S8@ PPP PP+ PPP  #R@SQs6 R0309Q0  RS`u 8 T`5@  Q@ch`s@ Q0 >RQ07Rh8P,dh!lQ_6,,Q,1SM/0Q8 0, KR0 ,0 R 0,00JPPP ;@(0P000 00CS0 XQ dX  X _PU  0 0CS0 00CS0lPU8 xO-RMP`   30o?Ѝ p@0@000 +00CS0 0S+ @0  00CS0 0Sw@2p0 00 3_ 8%ZP@ 00CS0ꕷIP  0]@%PPp 000 0OP Q 00CS0'_ gW KW EW @WW0 @7W 2W W t 65yL ~6_*Yh dĹD-鸠0P p `PU@ T P 00CS00P00kD 0@ 000` 0pP l^ pD-``0 `PPP@ p4: P@H l0D-@嬠PT   0 0CS000CS0Bk0S@L0y00CS00D:꡶ꟶꝶ̡ 0D-,P @j P@000 D-``  P 0 S P0SR0000Dj̠ pD-<`8 P@ j0`P0pX 0D-t@p P P 0S P00SR00000Dj -0  ဟ D-880@ 0S D>*HT <D-||0  Rl@0S D蘲n0S n00%4lE /Nm릙 `pD-ؠP` @00T 0pj@T@@n 0S @h믟-|"᤿ 0S\]|Xj@pDnڿl 0D-dd [PP @00T 0-j@TMQy0Dt -0  D- 4P؜ E-RM@  10<Ѝp`0a * P㮳PGP 0U0R00S0a UHH0 0P$ ꠜ t|d400pD-䠟R` MP ` R  00< Ѝp 0 0@;P0S&`VP@ OGP d@ \T Lw4O- i@} i0 `pp"<80\ ( P0P P PP  p0P 0p PP0 00  pꖴꔴH hD-@80 SG (๾ 0 0CS0#0 0CS0Di 0S 0S\ 0 \ i0  00o 0S 0S\ P0 \ h 40  00U@h0 h-0  1ؗ C-0@p@cDA@Zh儐`PA tFUPEHP  0h  A0` 0hp@-A !a Q0S 0 A 00`p 0S-0 1C BR0 hO-"M Mܥ 00C` 墴@P,Tp? T  0Q ppG0 ?0 90PWhX% d0P`@U P@U00S PU@KЍۍ Jd0P@UT@P0Tc X0T[  00 T@R R R(J0(0 _p0@0000000CS0(X 00CS0 0S 0S P 3 Pg3  @T1 0!000s00 0($0S$T@0 pPPT@X0 R̂00 PT@ R R eR(T@(|($0S$T@T@X0 RL00%, %$@%80 P8 @T@R[ R eT@p0P 0@ P  000QX   @ 0R0!S00S 1SP1@Q  D1  00 p0pꡲ0@\  0   ꍲ00S 1S0PQ 0@00@ wT0PQ 0@0<0p d` XxhD-X0P@0X0 pSP d0,Q S0\" 0 0PP` X00CX0000w0P0CS0X00CX0g`0S 0 0S XK00 0R0S 0S\ XO-0줟DMS` 0T 0Q 0& 4 Q  4 Q Q0S  0S @ 0P  ჵDЍ0 Q 0 (4 Q 4 Q Q0S 0S  0 P  ` X Rp 0BSiR5 0S2 xs 0RY 0RP  ն0 RB 0R: P  ɶ pR$0S 0Q ?   d4P$@ ᖸ  ᏸ 1AAጸ0 S  0PO0P0 O 0  a0S 0  RQ@"T @_pǏP 1 Pe00 0S 0SP!@0P00 08?T0SQP 1 Pe00 0S 0S0@0S* &000002 00 -@0S 0000 0 00 <0O---M@@ D0,H`1 nPB!S P `PPP '!0nC1d 0R! (  @?0S@@ xP0 `j~<Fz}{?Lw|{zyxN; : 9 W V U T S R 9!vx+ "D +5:@MS`jo5R8RQPnmJ+` @P0( ,$ 000CS0WژQ   WpP똰0KS0Sp1 0\1" P 0!R;+`P@p0@0CS0T@ ^ 0!RBP0A 0R@;  ,!PPP2 @`11X:*p`@00CS0 ڬ11X H000 0S 0S P 0Pd00@ု븰`PX 0:<*p`@00CS0GXpW 9*p`砰0@0CS0"T@X :p帰@01E0ߍ½@H `0`T0c bC1`i@8 ] 0S 0S P 0Pc00 ( 0S 0S P 0Pc00@ 0S 0S P 0Pc00/,P1  P1 ` 0Q1 ^ P Pd 0S. pGw 7'`@00CS0pGw\ p  H00, H0% 0S 0S P 0P?c00@᫮ᨮø6P@P&0 @P0XH `Lp 000 Rp ꨰ0 8@2PUꏬ@M R@2 0kP9@2p@!H14BSP RF PX0SBQ0`P0`E 0040 @@M00CS0 Qd<2@P 0 P 00x2 ` @P P`,`/1@-P ,0 08 <4ppP㜰pP3@P 003 0 0 P@[#.Pp``p0bp`ꨰ@0P 00 0S p@,r 0̠ *PP@0 P0`0P0000S`G@P08 <4@0P 00 0S p0Sp`pp$@Y7 B0,B P @0 ,B`  < @`T)P 0 0S ,Bp0S,BT 0S`0 `00i`N08 <4@@pPU(  @ < @&P 0 0S ,BN0S,BT 0S`娰0⨰`U@ᰫP@p <@ 0`pR0|p P0@(Bp \$ (B P|@ 00*P`地 0S0  000r꘰  0S 0S  (BT 0S`|^` ^000 00CS0``000@P0S0 0 ਰ 0S 0S|P 9 P_9`|0  0~`0 8<4@ l <@ 0!|PY `B0(B  @0 (B\`  < @``2(PPpS0 8<4@ |0Y# L@Y00 H0c@[ $ @ύ < @@%PP Ypp@ᯪꬪPl|P`0Q@ Q `x`R00 RPP` `V P@Tw  P < P%PX Vpp0 0S( $R 0̠  @+0P@0CS@00S x 0S x 0`V ᥩ0S$RU 0SP0SP |00CS0ژQ ᆩ0C0000 P0P0CS0p nm@ `|PxP`V R0$R @ P0 $R`p  < Pp.'Pp0p`R@x@0@ 0Pp$R`X p@0x R@@P hP0l`0 `   00CS0ژ[% ᮨꖨ0C0000 "p0l`t@0?V0/SRtl@?OR0S 0C0>0`00`PU 2l \Rd/^-0ϠpS `PP = P\00 0S 0S pl 0O0 0l 0C0ld?Q0SR0S\,0C0@P h 00d0 `  0`PP ; P\00 0S 0Sh@d`0`0S 0020 20@x;  ,ST T0; <); < 4;T w5; < @  T Tx; <: < @eTc: < @6` P@@C/ u0  n  K``^0SU Q00|1@0@1S 0|1!K 000S 00101 ☰01! <h<@`P0 @Qp`@ 0 L0 Q X0 Q Q0S 0S o/n?P1S0 V8 0 Q 0| 0 Qv 0 Qj Qd0S 0S m/> P!R 10CS91 BR y1Qqè0-0CS VX[^`[`0$0CS 0` R@0``p! `+``V㨰 p0\ R1S S 0 Q 0 3 Q 3 Q Q0S 0S g/f?8\1S| Sz Ss iS1  PWQJ P03S 1S; Q/ %Q @T @ ``P0PP(4PP 0 `00@ 0@겡1 R@@Qq2P@@!@0S0S1Q !f Q> 0S5ڞ 㶨5@03S# / 5 0 4 @2p 2 20SꙨ0009 8 i6ꞟ შ1?RQ ``0 (6@P 0 0`0 01~3`1RPUp `e6@P 0`m6@P ` 1 U3 `e/㱤Pg!R< Rg ?YdL7  Q- 0Q% c ,딑? i20Pp`S 0@0H0 002먥`1SP`P0cO0cQ1@T 0a30c0t8PP `1p 3pp` 0 Ꙡ 1 R ` I SB1p1 R /``s0Sj f001P0P1h 01!`90S0 ,00101. 01!'D 0  PQ 0 l: Q : Q~ Qx0Sr 0So Z/Y?_0S`d1S] 0 Q 0T : QN ; Q@ Q:0S4 0S1 .W? =\&\1S# d!R S 7Qp RU SS k 0Ra 0RX M$$ 0 RI 0RA Kύ  P06S 5S `P0S፤P0`PPv ᤤ```$d!`P`R \1S$0S$0S~0 Su ? 0Sgږ 峦0SWښ  媦랟 3 @050CS  >/ 000Sᔦ  o6  04h2S" |3 0  0H2 PS P"p2R  p6  / 09S /-0 //  Uύ N,1SX41SU{0 S VylU8SA,A Po 4[$`0S1 $ /`PV ,$0S$ 0S0S! 1[ @0P`$@0S[0STtr0$d!`PU`R \1S$ 0S$@0S0 S 41S0 S  V00U,1S0KύO00Kύ00M$OMO0$@R 7Q S m 0R6 0R. Q ᥣ0 R 0R O_  ᙣ 10 S 0` 90O_O0O_0QO0QU/" S/050CSEEHKUSA50S;@P 0 0;P  P`P `^P h; PR00 0S 0S;` `` -USA!USAUSAA \㘰0S 00\1`0``1 0\1`! @@u 0S 00d10h1 0d1h!P @0pQ000z 9 Qr x9 Qd Q^PX 0SU C/B?ṥ\!R 0BSA= <0S9@P 1`0 008 倁 ` vF 1P 8 PQ00 0S 0S48P儁 PP XU@ 0Q 0` 7 QZ 7 QN QH0S 0S A/<IP 0:S@@M 1S! PUpppa 0S 47 UQ00R00T먰0`0⨰P0P`0`:S 1t 0S 00101 01! PU6 0S86@P `p e0p p`0 ꖜP 5 P0Q00 0S 0S0 e⨰ 0 R0PQ 0Sp?0`$ q TR( R  10S ˢ@0`@@ vPPP0Sږ/ d? 0` 1 + ```㘰P `001` PP01ß@ 0  PQ 0 `3 Q T3 Q~ Qx0Sr 0So E/>00Sd1Sa S_ S& 0Sڒ   e1  30S J0` /꒟ 0!SpP2@P ` Pp 0pp`0 PꜛP 1 P6P 0S 0S0   0S 00101 01!@Q 0R F/ᡜP51帰pS 00`pp ` z0``0S01ppꄰx  pM0P@`P`<Hhp弰08!1RC 0JS0$0CS"P 01.@q@ 1`ꨰ@ 0HLD@H l0p0⨰0'bP   qj/LmPbx;@P 0`0 2` 0@Z*`pみ@p倰5 _08 <4@00P'`pみ@p倰 _08 <4@00P|Y / ꮘ|@pϠ0 8<4@ᄰ@~pϠ0 8<4@ᄰp|Y Ϡs`|`pꨰ0 8<4@ D1HbPp 08 <401H`0008@00CS0  mP@ PPP 0S 0S P > PL>  @yP0 8< B 40R@C  1HmP  [ 0p00 0S 0S P ? PK?  P@PI/@PG/P  Q 0S ? 0o8 41+@ p 09S cS ' '0SьqX2S} H2S 'p ~' |'T y' w'>`@`NA.M 'p X2Sd2  *|6) S' Q' ~'P@P`" 7p C' A' 000  & c'pP `  /+X2S``=@P 0 0P` vP0 ` ' '`)X2S! O*0  'x2S "`2R  -  &09S &G>' & `09SH cS1 0Sh<@P ` 0 0 !P < PJ00 0S 0S0 0IGG J-- y' -9Q  pp4;@\ ; a  0A0@0@@ 000=ʕP/?iP @PP0`0CS`0 0S 0SUP P: PKJ8:  @p弰<08D < 40  cAH0S Y 0S<Q 8<!Q0 0000CS0ڨ  0S 0S P (9 PJ9  Pk@P0 `0C bSBqa0`W8@P  8  稰0娰0 p/ 0S 0S P 08 PI8  @-0P 0@ Ƞ̌Č,?@)iP&t20P2P1a`x7@P  d7`   `p0pp`@0 P ȠȞLČD}?~/`PhP@p 0S pp u:!0PuPt00@t@U0?U00S UPT@BeSh`娰0 ⨰\6@P  5`   `ꈔT@!UPAM{/iP1PS@z 0GiPE5!1R8 !U00@T00S0kS& 0$0CS U0<C 기!UU U@08 UPP T%PPPy(p0p`0p``^P000 r00CS0ꨰ08 <4@T03 0 D\PF 0LP R 0p.K0P 2 0x @`0 8<40 R0(p,$@4p P00 0S 40bY 0S[0pS xoSl pಝQJ  0S$ 0S!  [ 00P00000 00CS0 娰 0S  e0 0040̠ 0P@0CS@00S E[N 00CS0I ;F,HPdxwh1H _pqS p0@ Ƞ̌Č0 @eP0S_ 0 mW0@00 R P 00CS0WT ἓE0 ߼1H0  ip 311`P 1  ꦒ0S 08 <4@R04 P00 0S 40 L0@@Y 0S[ 0 ؼP9`0rSw sSQ  0 r  0S# 0S   [ 00P00000 00CS0 0S G0p00̠40 00CS㜰00Sv 'P 0Sځ ufP 00CS0 ffP eP 0S$Y Uj4@P 5  Xȑ0SI 9@0 8<4` EP0 @@唼00CS0hژ`Vb5p`VZ 5%0 Pp崰pp @R0000 0 S< 00CS03`0000S! 6@\ 0 06 000 1 ` `` V  000\\x@`E]O08 <4BT ' 0S YP 08@P0 8<4BT- ,( 0S" 00CS0P8@\ 0`0p8  †0p0pp0_P*Eꨰ08 <4R0p P00 0Sg @ ̠0@PS  0dPL 0dPPD 0R ՚ U`(А0! 0P00 ? 0R p P00^地  0`V/ 04Pt0S@ 08 <40R0p P00 0S @ 0`@地T ` P 0GdP 0@dP`0S[v0V.000 结 0  00 0SW 0 0PC 0!0`V  0S 0S  000 00CS0@@@Xߏ 0@ P[ 00CS000!,0S @0S@b R yP Px`P`M !P p"P㜰 ! Bp帰@ D01SE-錡1@ MPp=cT`S \1  Q 0I D1 QC 81 Q7 Q10S 0S 0ဗP 0S 0 0 pЍ2 P000S S00|00S 0000 0 00 40p Tw<4HdX|K-`MH0 $ pP1 0FJ,0WC  QXP\@`d80S<C<PR R<C<@A 0CR<C</ R< C< X W hR 0 0[q  R000Ѝ0 8<400 8<400 8<40@0 8<40P-4H0\c P 1l@P:\ 00^Q0S@P*pD--pM` -0P!S  @1@$$! 0lЍ½p"S 54Z 0@ 0@ @0 Ld 0 6Ѝ½pDgH ,HH00O-ТM@`A  0PP PeX!0p  iP0 Ѝ$0SXP40: S- X!700 /X\ [ 2 1 0001S 1  0@DU @ P p   0 p ,a10@00 0  00CS000CS000CS00S PUheb@T \ \\\0  0&k@ PX`x4WO-鈢|MPX p PP. 0S `V$ W882@0  00W 00CS0 U 00CS0|Ѝᤍ`0 炤P0@00"] 0pR00M T`ᇢ0 P00XWP#,0: S00CS00PV00CS00pXὌ# P000@Sz^P 0S  #WP,0: S  Pn00 *G-錢tM`pPA 0 `vP@@0dSuT'aP \WP7 0S1Y/@TY V PU V1@ 0/ P 00CS0 tЍIPVT 0$0: S ] (^P `V0S `Pa!P 0 0`rVᮌ@T \ \\0X  0`ꖌ꓌@ *$4W_ :_(/00CS00S{ϊ\P7 -P PT@T \ pŸpP2 hŸ  0 JF@1St   xt0 R^ : S> ,0: S 0@00 VP 00CS0 v 0W@00T \ @@1 00 4@,0: S @00T \ 0ފ@: S Q| 0R 0R00e< PX,X`*hx,S(@O-(@TM`P p1P8 0-S 1P. P@TppЍ1P 0-S-0C0-S-0C0S@  R TT0 0q mjg TL\A-M`Pp`Y 0@R00 R% R 0 Bm^0S `V 000  BR Ѝᒉ`^`嘝P``P 0~S 00CS0 PY0 @00j O-H4M@0QP00,@ `404Ѝ ֠PS0 hU0PPE `0 Ur UR ,@TE pW3 0 0 P@ 0S !0 .VPpW,@00t =0P 00CS0,@ R 20@ꚉ  R 2ꐉ ,0@@S RD2 0 TP 0UP'f\1@`Sp $T* 0UP@ P1SW00U00S 00CS0ᣈ \$ p\0 RRP @T R0 0Wq @000, d]Ph@,<,0T(p0 0(](0P ,0@T01( xLt*G-@ \P/P i0/S\SZ0@p\S/S00\S/S SPJ \S/S P0S00 0S `0S (0p\S/S00\S/S S` \S/S `0S    0\S/S0\S/S 000l00 yP 0:Sf C\c\,0OSoS(0MSmS0P4PNSnS 0S P00 S000SP :S0SP L\l\ 0PSpS0TStS010CSP\p\ 0RSrS0NSnS0S N\n\ 0USuS0LSlS0S A\a\0USuS0XSxS{0/S\S0PS \S/S0S \S/S 00 4   hh0@-0@00B0P0CS00*E-MP `p`ڇ@~Q+ 0 R R Ѝ 0PU 0dW0  b0001/Q00U 00U 0 S/S 0S/S0dH T0D-``0@  P R R U  [0n@ji$ TK-pM 0@00V0`00  BR N P@U  0j[Z 0PU0@: PU@  0O[?   0PU0@PU1@A0SPU0 !0CS0Ѝ`]G- &0/S@* 0PS/S 0S/S`eV 0U0~R00S  p6 Z0S@ p(@  yZ lhG-HMP P` 0 P@ g  [Z6 `0S/S \S  0S/S \SpfWV P~U 00  0:S =P 0Z R@ Ѝ - P l@-PM` pUY@TPV0@00  BR 00C0Ѝᡅ!@YTG-騢M@ pKPU` 0.S 0S d2 RB R ЍV 0S/P :P $ o0PPG 0 ^P 0\S/S 0\S/S@0\S/S S00 S/00 0S0`0V 0 S/R 0 20PP ˅ 0 QP 0//S   0SḅP`P0/S S00 S@0/S 0/Sv~Y @0 Qn00 g 0:Sd@b ThA-M`p᱄PU@#000|0P00  BR  ᇅ m00CS0ЍᾄỄP  YUpD-@ ` 0P00P@+ 9< :00CS000CS0ڌ0 Q p0 S \/S0Spur00CS0ph` TD-阠0P  ` R R .PU@ U@@Q 8pBPPQ/P8 TpE-0䠟MS@pP `P@  9XЍW }tt  03P`W j000 0`ؽx PtO-`M@V  (@<8 ,";˟Xp0P0  0pO PX0S @00@0`V@fT$@w@( 10RPe;0 R] RW 80S ( R000,0Sj T X7 T0 0CS T0Wt:LpHP00T ,NXL>@ P00 $ P00 H0Sf S_  L\XP8H0S5D@ L0&XD rP' 0LXD| eP0L X0SD 0 00T00CST0< 0R40 8\4 $0`RT@C^݃T V 0 $ `V@0( 08P040@. <08\0S%( R 00CS0Y P 00CS0 P 00CS0 s74ߍ߂܂iT WP+T0S<0$\0S* d7d 0㚼< R< $0`R47@ ,WV 0ሼ$`@ V ~ 4  0w6^5g8\.4 $0`R'T\p'8 R >T $( \@0P$0`Ve040c04! \p4$ `\T( @0P4K$0`VC040ុ<:D`VP 0L V 0SD 0 5P@T 5  00 0 Lf 2S <@ @000J0  D00CS0}a}@00CS00@00r P &0@08 @0 80S 8  \qo4D-鈠Mp @P`EsL<@<P@ 0'Ѝ4s$$0 0@cT  0@-P@"sL<@<P 0Fʫ0p@- M@`9rP  @L{P 0 FxPᯫ ЍpK-@0M PB U`p`DA @ ! B}@᛬T!@T0000W# D 7 囯{@T !@00CS0T0V&0Ѝr 7&0`0p@-P00CS0$0@`T !@00CS00T f R00 08 R 0 0`&p@]&qqp@-P`(@ 0P0CS0pq0@-P@*0P0CS00qP00<0Q0@-P Q @<P 0(0sS@0@0g00D-̠ M 0 `pEP0P@PT  Ѝ rtt0 0@;0@q,P 0@T 0PU@ꤌ D,S0D-造RM@P  /FP 0S HሪЍ0 꼋 dO-h M 0 @%EPnP@D@00CS0yX? 0 !q Ri 0 0@TU gP!<`0 @p < @ LP [\\!0 `  \0R\00 P'  0S Ѝ!0@000 V0P0CS0U t p dd0 0@m p+q( {LwO-P MpP` U쳟# 0 @@P 0 S 3=EMV_dmUU p0SU T3 0 Ѝ  0E@ @ U  0 ER20U2 E00ESh2 E00ESD2 E0?UbUpE0Y01 0 p0-S 0   0@@NP0S100Y0iS  R{D1sSY YpU1e ! 1 0@@P]0S S UqqS0 `L0 `E ERt0;0<\0 04Hyꌈ x(y44`8y@ t @-@<@ 0 0R@# @-`p@PkT  0@ 000P0CS0 ᱬᑜ0oPD-鐠`@ PpP pr0T0o@o 1 P ぬL D-RM@Pp `, P   0ǨЍ rP QeV 3X 0RT3&8Mr꜂ ,TD-鐠`@ PpP p0T0Go@Do W P ꐁ p@- M@p\n@PT  P ` (0 sS ޱ BPɧ ЍG- MP `p@SP@ ࿱Ყ ЍoV  @0 @#WP@  ḫᘛ 0@ 0X 0D-H@P P1010 yl0< P01300D-P 1  01| 0@  w 0 q 0 k 0 e ] X SqPkPeP0~ L $08@TPp@-R@U 2`b $Q P  4Q PppD-鬡M@ rTP`7R $Q P"0R:' 4Q P  "("0R,"0R202|0<("0R ,"0R202ᮚЍ2 ᬧ ៚202U 0"R20ã22ቚRዧ  | `tPp@-@` 0 P U@p 0P00 0S!E-@吠TpP`  !0W` @00 W HEw02S00 2S0  0@z D-蠟Q 4 Q Dv0BT 0S @T ^0 00R00Q0 2 Q002 R000 0SD*! By p@- B0`T 2 0P 0& U@0B002T 0P 0 U@8Ppx0820 0 0S 0 0 0S 22202"2 02"2020D-82P@倠SM(, `0 R P 0 D  02802Ѝ0\w ?BʽD-H@ 082nPDZ v 0,(pD-TR@`P U U ,pDu4Bp$BpuTv D-4Q  Q4u$u @- @00CS0 0S@@ 7k@-@sP (OP@dPO-PM`@ 8 T &  l0pS 0@00 @P` p  0@m PЍ P` 0 0 hPp ( 0  put D-x M@  YP `  LPd2sS 0 _NP  Ѝs  0$" 824"2222 2(2,202-2 2$ 022"$202(,(,4242O-0@MSp d 0W 0b0R0`000(0,0$0:4$Q040 0  0 JPF4@TJ D:T' `VP[ 00S 00 #\ ,  R (0S $m ^@Ѝ \0(0Vk(0S $ /nP $0S# 0a0 00<@T: 0 cP`[P 000C 00P PP00 05P 0`c R p Ѝ`@<K-tMH 0 L0H08 < R P@D04 `0\ 0$` @0@H \@4T\ S8`@ 00<`0 C<` $ L 0P<@ `0< bD 40R`  @00 0@\ L`@SH0L0bH0XX T0( ,0 hO-ХtMl 8 4 &P@ @4 tЍ0LH8$0f^ Y, $ 0(0(RK 8H d@0Dh@pl@p@T8 $0$\P X0`Dp

0U<` W P6*0 S ` V P:.`V*0 S`F 8 4P0DP@c8P 80Dp h0` V<:0+L( Y 00 Y$4,0 80 H0@904PPDph0<s$= K- p 0MW,(  0 0S0 p  0W 0 R( 0M 00` 0S0 Pl0 e0B S $ U@@@彠 e0( @ 0 0P 0`$  @P`h(p000 p0Ѝ 0 PR0S0     ( ;0,P(0Pp  p 000U  $0@ad 0 0d d0 ( `5(0 PP(0A- Pp@ 0`S  0Q0Q0 JP0  W A$Pp  00 0  00 00C-pL@T* \ PU@TL@ PU 0 `cf V ڔ000@ PU0S C胖P@p@-0`l@P0S p@[pK-Mp @P;PPЍ`e 1P PU0   ;0 0 PP0;0 0,00 PU0;0F%@-` lp@PG\ 0@ K-PMS;0`l[[U j^[0 00V0 L0S' [?  0L@ 0R* T0`d00V0;[0  @ w Ѝ 0   ;0 rP P00 p WLpPp 0 [ [ K-LpM`l @RP1P!00d0CU ڄ0T00000  9X0 0 S 000Ѝ0HPE 0 P P 0S 0   00K-pLPMp44<  <`` [!  f@B4 80?#AUU0V@f ┞0 [P($@,+ 9 0PL0 HD0 @;H0S( 0 S 00 8  000PЍ4L 000LD    0 PH`$0 P@` L0S4 @T 00 0h04$ pL@ < 80qX090H@ 0@`P H0S @,  0 0$P@`ɕ 0B@0HD 0a c RD 04L0H@0 0T  p 8D000z d,  0 0P@`叕H0 @@ HD0 a0bD0K-`$pP@ P 0R*0S  R:0SJZW  . YP 0 S:0 < :0  .60 T0#02S  0 S:0Q* 0 S0 Q:Pg d Q0%:#0%*0 S  P2W  W * 0 S R:0 T *0 P 0 Q:Q0%9#0%*0 S dUP {K-P`l@P`{@ <0W0  \00L0S 0P [ 0 0 0P P ,L0@-Pl@0S 0 <0S  S0@00P000p@-L 0PRP0`L0 @ T V HPp 0H0@-PM`P@ 0S LQL00P0@@Ѝ yL@0P@T  QpaH@pHpT8 0` 0CS7T1 0 0P0P @paL@P@0   0  P0P000;0 0,00 P0;0"`#@/ @C-PM@pP@OP<l0 R{ ?`SPV@@TnWg Q0<0P<0S  0S0@00 8P p`YЍ000 P  P 80S00@TK0p` 0 !  0`vw 0008p`j P  0000 Rl!p@-@MPoP3P/l@0 R( `VPP P 80S0 p V PЍpq,!0 0080@-@_0 0-@-@`PPp 0 ! 0p  Pq@-@,P     h0S  \  < 0;0  |0,0P 00CS0ڀ 00| ]V@- @0  P@0 LP  0C  Pl0P 0A  P@ R  0C R<P P0c R 0A RQ@- Q @80`S 0S 0` 8 0800`G-XPMP`@ < 0 T 0S8  0 P-:0@ 0@姏00CT0 p`0!0`嘏0@T0!0㍏ =  ЍL_@ F  Bl L$t<D4WO-鼥`M PFP?h lRp 0[p pXV UPQ P0bS5 Y1 Y0bS Y  Y0bS Y Y0eS Y Y0eSx Yt Y0tS 0\ Y Ѝ J 0 XD 1PYJ000p0p0SY: 0S 0S2 S. S* 0S Q Q Q 0S 0SY Y `PL<84$000p0pBB PY0SY0 06 00 $ R(pp ( Rt 0S 0SY Y(BW,w@m@e*AA P*YUPNY yӏdAdA jPY98@` /0Y [AA PPY   Y B@@ 3PY l0Y 'T0D@ l| `tO-`@̨h $MpR P (0 Ӎ$ЍPPPl0bS U0bS 0 U bR UpeW7 UeW U0tS 0\   0   PP 0 P 0S S Y XX'  0|. 0@@0TB 0pW@003 P0@+ PP lWl0G0fSf0C0S  cRc0B0rSr0C0S0@ hP0@ LwPC0@T 0@ :07X+ pPU' aPA [P@3 lUl0E0fSf0C0S cWc0G0rSr0C0S0 pAP0 0&D5P0Yr  % 5  0g0 0(@F@ 0tSt0C0cSc0C0pSp0C0S $P00@P 0@@0J` Pp 0 P 0S(0$0 S S Y$ #  00 $ 0 ( P0<0;0 ( 0 $ d P0S PM@P <0S6ȍ0 9@ 0  aHQ LQ @T R 8P 0SG 0D `8?080 P@L@ 0H0P 0  00 bP@@ 3PU  AP4  "P?@PfT# lT nT Y LL!  08 P00 00  P0 00  P000  P AP 0 S 0 0  ; l( j8XtO-`\@MTp 0 000PS` U@Ѝ0V\PP 0 0CS0 0S 0S R 0R 00 yQ| hE-X@T PM `Up 0S6UЍx~v~0 #00T 0 R0Ї 0 R0S~~00!0 0  P@P0 PU 0St pD-`|P0X@ @   L0S Sd @P 0 p ஬d t0D-@|P0  X0 L0S S0d00D0 d}_0D/~p tA-@P`TpP  0S PT 00 ` pPT 0RX0  X00PX0lA0S 0SPD-@ p `'P TP. 0S P 0S0SP Q 0S00QR00T00T0X0P  X00PX0lDC pD-\@ TP 0`0S @Tp 0ST00\000 0 0CS0pD 0S 0S\ @0 \ 00 P hO-(\@P`Tp  10S @T@0  (\00\@ `0p0P0 0S0 0CS00T0 0S 0S\ @0 \ \00 O h@-P@` p|(dP 0 Sז@}NG-逡p BR MP`  \10" Ѝ 0Q@7 U vP ᇍ {P  9PpЍ00CS0 0S 0S P 0 P0 00`I0@000sS ,P F :P 0tS0dSI`~P hLD<0D-0HHpP  @xP ,P 0S0 p00PG-鸠 9P~@T p`l R 0R 0R 0V t@T P000T LD<0SSS@-@P@-@P,(  $@-@P0@-@P4@-@P8@-@P<0@-"@PR 00CS0 02U 0000I0@-@P| R 00CS0 0|0U 0|000HO-4M 0  P ?00cS00pR 0X Y P2 `0@1P 0P 1P} P@i PU`0 07 0S0@SYX`P01PG P)0S 000!0!@1@PU 0S0!!@*Ѝ0S0!1!@01P ,PY 0!!@@XII0 0KP0S KH~0 KP0S{ Kw000P DSPHH@VMR= (0`D8"0 2 |00| @-@P@E-RMP@ k CR 1 0Ѝ`1p P@ 01 0Ł)P WT P@P@71 0@壁RgHP`H `p qH ` R 0 0PFH`BHTP(0p`6Hp lDd*pD-䠟R M@  00 ЍpH` PP 0||0 09P PP440 0P# *O-騡p BR MP@  10 ЍG  P` 0441 0F NPW  e̠ 0 ~P XJP P00CS0RP@IG@@0 0@峀 F  t*O-鰢P BRM@` 20 I1 ;1h20@1;1ЍQG<p PpW EG  0PJ 0p p0W03GPp   04;0WPFLF0P00 0P00 S 00CS0bF G 0P SAP` ᯀ00 `00CS08Fpp0 0 IP 440 <Tt* E-H` BRMP@  $10ЍF Pp  "KPV 0Jp qIP@@pp0 0@L L0  0AP$ 0 t*y|yD-锠R@  007LF 8PP p`PPVJ~ 0D-РRM@  00 Ѝ0 F  P P 0PS $FQ0 S RA EP~ O-XRjM@p ڢ?0 R 0cSPPU 1 0jߍE P T- T Y `EP E 0 PY` ᳻E `P  0xP@ ?G`᜻ D-pRM@  X00xЍE xP E7~ O-ȢPhMpU0` 0堂mE0-S@ 09P[0SPU @V@2  08hЍ1KE0&Sw `e0Sl@Ta[ 00!  P@ 1 9> $|  0P@,  |TB@` { >L@TBx@T B 0 )Pi \ @TB[P8 {q y@DlO-RPᨡ BR``V M@ YUW qBp [P 0 @@1 0`{ ЍXBp CP 0. p0W0 `0А`0 0`P0S S10 0pW   0F1 EP $00,0 0  y\LE-@` BRMP@ ApW:  P V! G@0s PЍ @0 0{ 0s t@ ZFP  0SDzAp $00< |*O-xR0M`@   \300ЍP<,0 P@ (0Ppc0, ,0P Ÿ,0 ,P$0  0@0CS0T{\2 @0z$ 0P` @QPp0 10PL 0 BRC >S?,0 @ 8  ,1 PU, U z0S@ D D p 00UP0,008000p]yg ?z008[ 㵃@ywylৃ$@ly$00CS07@4@l@M yDzP4lE-<R M@P   10 ЍpW9  P` m0  Q 0 0yW0S 0 0P0P XX0 0c:zv@p(  A, L d 0@-@|PSy 00D-xM 0 PP 0S@cD|Ѝ001x I 0@-PM0000@2 QgU ]P@0S @T000P 00CS0P 00CS0T 00CS0Ѝ0[?W?U?0D-騠Q MP " @T Ѝ0x  0P@ 00CS0T/? 8E-P,M@`p B qB@ 0 @P@( q VR@C 00CS0Ѝ> 00CS0 h0N00>  00CS0> 0$ Dz@zD-P4M `p E @ 0@xP+  OBP@ 00CS0P V@ 000Ѝ> 00CS0> t 00CS0ʂ> 0 HLzHzD-`M` @,p1CTPK TG ,1ˁ 0@ @P,@ CP00CS0 0S00Ѝ0禁+0;>00CS0j0>00CS0%>00 I0FPzl0@-@_M 0Ѝ0pD-0 pPPM  (P`@0 00CS0ЍpЍpD=Ⱦ P0D-鐠Q M P>p@ 0@P@ 00CS0 Ѝ0=@D D-霠 M` pP@l0 @@gP@ 00CS0 Ѝ=꨽ ,G-СRMp i 1`P@0 @;P@SU Q  00CS0Ѝg=> 0 jP@( ?0 cR  >0PS   =@ wQ 0 0  v00CS0)=40 h 0P` 4W$] $G-ࠟM` 0 PP! R ڤ@p 01 0psP0S@ S@00CS 0@Ѝ$$0 0v z@!D-XP  P <0.000 0P00 P!HC-pMP`@P 0@@p@0000 T !0!@0T00@00ЍD-pp0 p`V \ \@PT 0  P&000V<`̸ h \!pD-0x`p0  P0@PCT 00CS0@TpDE< 0 yK-P`p0 00 V1@ 0 W@000aq0@0 t8i8 0@S P $0+ u000 tbi00CS0V 00CS0W 00CS0 0S;;;@E-ĠMP  `p)+P 0zx P U @  ("4<"<0Ѝ  +P 0Su d!@-M pP 0`@P`F  0Q 0 `P7 0R0 ЍPP/PP+K-pdM~0 00@0P0CS0/u `0S000  R00dЍ\$00@DPL`  T0  H00  0,@8P@`6;0@-P~0@00-0P0CS00;@-pP`z~@ 0]0P0CS0;0@-c~0@00 0P0CS00:0@-P@T0 ; ᆱ00CS000:0@-P4~0@00o0P0CS00:@-@ P 00CS0P R 0 @0CS0T 1- :D-$$0 ,P pD-騡1M P@ P] a 0R P 00CS0OPJH1P ?81P9000S, U% 0P ; `; 0R ЍphP00CS0 0 00>: 0S`0ƃ00:0 00 &:` $ (D-,,0 竔0  z0D-440 P瘔@0UPP0Ю G-DD1@ MㄔTP :qP 00CS06`P0T@@ 6} 0 = 0P000 00CS0P T@ @ }0 00Ѝ8 94 9ꈮ  ($pD-Ġ@ P 00CS0%ڠ0   @P`P |0P0 @S T\0X T0pP  00m9( $(zz-0 0 zz0D-hQ@P  nL0 0R , P@0 0000 zD-騠  0 Q @0S P  0Q R 0 0 00 R00 0 B0R0 ꀫ zzO-M<ܢpY@`  0TP 2 PU 80S 0  80V0P00SЍ  00T P| 0SP k  PP" 80S @T[ !  00000 0 08P$ 00CS0 00CS08 0S 0S P 0 P0 00@|8 0 / 0} PP0P0 P   PP0UB8@W , bqq8ꨪ h!K-S(M  0 0 0 8PP $ " P$0S 00CS0(Ѝ!8  P$0Pp0 0@W` 0 SP' 0@T  $0[8 @_Q8 0P /SL  lO0 04 pR 0  00C 0- 000̥ @-@P 0S  0P0R00SE-鼠p PP@` 00T @T@V t0`T 0 0S  P @T0 0S  PP z-M0#ЍO-M00 0@ࣟP p GA00 ? rP 8aP 0 S tt3 0qЍ 0Ap00`S 0 S0S +S` bSVQQppwPr 0 FP `P Q@RT WTt RTh AT[ CTQ ETG NT6 TT, BT, P00 `Vv[ 0S ! 0p 0S 1 0pZP| xP| `P{ DPp (P@p P 0{0 P0pP0p Pp w 0S4 p  (< !,SA""("D"\"""""""<"""" O-霢lMp `@OPlЍ6 p P" i?PPv 0"02 0%W "0 Pa 0?PGPP0p00 @60 QP 00CS0(Yp! Y 00CS0 5 60S S 1@0蟃0nj5x6@60P 0 o%pb6@ PP0 0P ((#\,#!*- @-@@0D-HMP 7_@\( 0pЍ0 VO-餡Q`M 0pSP ,0S   `ЍNP`@ 6@P{00U00S Pp00U00SV 00CS0"{ 0H X@ ( @4 P0,P P00` 0` p@ H05괜 0@-@PSP0 l R 0,0S 0\0G-Ap 0PS0P 00S BNP` |5@u00T00S V 00CS0u 4 @p00PT00Sꐚ O-XXB  M 0R`p_NP PB 4@T?  0"p 0Pp 0S 0SЍ!1 0i 0QV 5@PPP!P  0 6n1V 4@0P 0 ndMPP 4@0T0W00S U 00CS0W(4 0  @p0T0P00Sd l *L#d#|#0@-P@LP <0S 00-0 ᤖ d0D-@ P0耖 D-@ T 0@-@PP0 H0S 0.0D-M0#@ `P\000UM w@ 0`(0P0CS0$\  00CS0Ѝ 0S 0SP 2 P 2  003 0S 0S P 1 P1  @m3\  0pP 0PPP1p01PI nP# 0PU0 0CS0 0S 0SP 0 P 0  00/30 0CS0P 0S 0SP @0 P 00 33̕ h@-p`@PAP0 L \0  P@-p`@P)P0 P \0  8G-錣3M `c:P@h P@p6 0t R 0SW PP5V  0l @0T0W  RW DP@  00CS000CS0 P000Ѝ2200p00 DP` v00CS00p Pp t R 0S\ 0V0P00SH0X 0P00U8  DP@( T 2 `2 0R *00CS000CS02-P00CS0X 2ra0 0kP #pD-$`M@ XKPP@`ЍpP`3 x0S! PU?KP@ 0 V 0Tt, ,P0: SPPX T@-$M, 04@80  @00$ЍO-$Mp `0PP000 p\( L T0 P@L 0S$ЍP0k T !R@L0H1PJP 1@2P 0 k0P@ 000lPP00CS0x j1 P 00CS01ft0P00 ,Pc 00CS0[UkH  0 ]PP 00CS0s0P00CS0 0L 0P0 0T0%k00 `00  0S@ 0P 0L P0 `0L0P0CS P000 0 @ 0aj 꼌 #*##Tw#@-M.Pp $0`P@0 \0Ѝ 0 0 00P@-@ 0S 0S@\ 00CS090p@-@P`oP0 @0 S ppp@-/`PP 0D0S @ T <00CS0 PUp/O-餠M 0 `0  P@ h0pT 08PU V  0 @TЍ/`ꔆ zO-阡M  @CP/Xp1 QS (0S=/Z0@s  0@`0S S 0S SPfU 0~S rp P@[ | Ѝr p~uPP 000000CS0k/ ᆨ؅ Tlp@-@`P@P 0S PpP 0S pD-|MP@ `p/ 0`PЍ 0T0P00S 0 ȃ TO-tM 0PP D! 0 DSQ PUЍP`  P00\pL 0/@Y\00CS0 R.  P @R000S@Q  0 00< T@-`p@0T0T00SP d0S pP @-`p@0T0T00SP `0S pP G-젟 lM0p PP` 0 P@  0*0S96 DP lЍL0T 0 ?#Ā $$$@-@P0 \0S @-@sP0 T0S A-`p`@]0T0T00SP h0 S pP dC-M`@?P9 XPU6 V ЍPp ZGP . . 0S ׿P 00CS0- A00CS0 -pD-MPP`P 3 0S, @CIP"P0T0U00S 0 R 00 pP  SIPP @0T0U00SЍp7} ($l$-0 H| Tp@-`@T0 Pp $0S 0S 0pD-D@ P (0S$Dp{ h-@@0  R R p0 0{ T4h0D-@P@ P ;P  @P0004{ D-llpP @`T 0SP@ T00SU0000z 0D-@P@ P P  @P000`z D-llpP @`T 0SP@ T00SU0000L z D-8P@   @00y D-llpP @`T 0SP@ T00SU0000@y P0@-@PpP 0U 0 S@!0!0Q000P0E-鰠0p P@T!  0`  W`` `PP -`P0< 000 0$X6 ,@0x h$D-0Ƞ@SPp ( 0S 0S` `,UPP h `P00 0H'6<0` 6Pw $$D-鄠p @P M`Q ,0S00ЍP0 00 pv pD-0匠MS@P`  P Ѝp0 P0 @ @ 5u (%D-0唡MSP ` Zx! 0S M,@T \Ѝ7P@P1`0`SQ 01000   @,@`@P`@ Q!0!0Q0 p 00C0 `5\5$u X%|%D-阠P @p M`Q +0S0ЍPU0U1 00s pD-p`l 0@MPS +0S0ЍpP 0r O-$M@Qp # 0S + RHQH$Ѝ Wp0`WpX0 \ g0S@@H0 h 0$R00S I W@3#0 0 Q00CS0%@ TH0 iSR0hH@Q L H11! Q0@00T+ ! 0S 0S P 0P 00Pb*\P` T`000 Q!0!0Q0H @T  !0!@0 T000C0W!l W@ 0 0 Q00CS0@ T0 iRH ! Qx 0S 0S P 0P 00P)@4P 4( 2000S00PU@PU@  %(0U !000 vP@U 0R0 T000d000c00 `Ѝ g1d  e &0 00 0 0 0   E-0夠Xp 0aV ( @T  R 0S 0 0VQ0X&1 `Xc &G-0ܠpW` QU 0 @00CS0@tTP0pW0P Gg 0S 0S P 0PZ00@&b hO-鴢pMR `0 ̐$@ 0 P0A0T 0St @T l d Ri V0:Sa p 0  AT 0SA @T1@PU6 1  0  0V `0@00 0S" A p0  ЍO Zv ᕸ0  7&P0SV  0S NP0 0:SpV  0S 7P~ 0X`@ЍQ`` `\a hp@-`MP &@ 0 P 0S PЍpA-X0M`rP$O&0@00 @& 0$ Q Q QЍ 0 0C 0 @-\`0P`^pX"\000@W0 0` @ \C-MP $@`0$p00   0Q ЍC-\pX`$B PķQ"0fR0"2Q Q1 fS01 Qd0S 0d0XP` pD-0MP@  &F` 0  P 0@0S P00CS0Ѝp7%00CS0Q 00 1000C0  BR 0S 0S P 00 P00P% \ h\ 0 R1 C-`10M0S 0CS 0 X1!0 0 P@T p% 0  00@@THXP0Y SЍO-WM@ BMR8  70:^ߍۍ 0<PPJ.? ,00 B%0:V/ύ,$ (4$0(0C $0- $p B '=> 0#!T0SW T4 ƟP `V< W@ 0ㅛ 0~ (&vP@@0m mPP W00T0SmT 0SPT00S 0SQ(`V`UY 4 P 0Sp, \VH 4P@ \3 4 Pp(4P 00 00 00854P@%%`@4 0z02,0(.$, *(>4 fa4 0]p4 0S W 0 wǐ0 ,n8 ,i (e (` $\ $W  S NH L(pTtxHhx0X@XPH`hpH0CpG@D8 PE`FH  p|`@dPl` <0Pp@0`0 R' ,` R vp`0 pp 0 d0( h0 l @08 0$  `-l0 "&]80Sg @c 0PmXmX pX0 B0CT# `lR7 R@ h B v\0P#8 S ^00 _\0ST  f0峙00CS06#300CS0, 0\"0iS0bS 0  0`0  0\V w# P4St  [h#0pSp>Y &,&'0'D'L'X'`'l'''',Sl''O-8P M`R0  0@$p 0pPl$0Sg bS0@TPd0ES5  0 ލ :Pp(  #  U40SX* U p ş P U7 X@ m f ((^P@@U UPP X00T0S T00S 0S(PU0\ U ğ  л P@ 0S @T 0SP 0S 0 S P xPm 00CS 0 0 0 @ `T   0\0R00S X0 07\0VS0 R $0S6  ` 0U(0 0 PS (0S(0(0 PS  g0@S S00  @T00" 0%#!1  0 a[ 00CS 0  ^` @d P@D`FTV mPT10Sa8@1,81 0 3[ o H1 0 P%[0 0a0 1! ᇯPp GZ1!0SS@0!0-S [@Q z0(,&l\((((()'@)'O-00 Pp`U 0S5 (PU,P@@β 0@ `(0 PY ` P@ 0S \\ P@  0OG0SܱPUJ ,&E-QP # P  d0P` Ѐp@ {ZZ}Z qZ`Vx0h @T XXp ^ZcZ`Z TZ(@TI &p)t),P@- @T0D-xxP P @(  0S $0S 0S@000pPP Vᱼ\ W 0P0R00S $ I0$9 ))))0dPD-餠R@p ` T0P` X0 d0X0d0 S0000d@ $(`@C&P7 *0@-`@P0 `00Rd0$0SzX0T 0CX0 S 000Aꃨ 0 0@-P,`p@g 0@@-@@gpD-XX0` PL0M@0 @嚆,00A @哆Ѝp86 $-M0, 0QЍ2pD-XX0` PL0M@0 @k,00A @dЍp|5 Ĺl-M0, 0QЍO-p M0vY` @T $ <  @ @G0S$ލ$0@PvAxP2sV0@ 0$00@Ş0`00PpL0T@X@\@庞ᷞ$`A@V@@@@@@@@@@@6  D P`(p⼑ẑX@ T  ṑ 㵑 (᱑ ᪑@T(٬-+P 0`3 0`xx0@ 0@Tu:ULL  0Td0SS(0$  k4 <4H*d*x**p@-PP@Mj `R8X0ST0 0RT000Ѝp@P &,T æj`h\0ST00T0Ѝp@1PP 0PP 0PH0H 0P0S @-P MP``@┦ {P p0 qP0(ѝ0S@0@@S71S  0S@UP0 zMP0P 0@T0@T0000 0S0L0 00 Ѝ @@P @-@@G-M@ PpT``U P 0@Tt0@Tm0 S0 00@d1 @ @0S 441 0SЍҪPPUԐ Ԑ@ P ĪP @TU0 PSz@ឬ 0S00A00 !@Pɫ@P0P0. **Q@-p`@ 0PU0\ PP0U@O-Q0Mp ` 2 @0 P}0S \R0Ѝ h2  @TY T; PU 8ǪP" $` 1PP  0sS@@[P  0vP PP`PP  0^0W HHH1  0R1 0R0 0@'\00"\@ 0000 @3@00CS0 00CS0TfSYFI+ ++(+8+L+p+,S+O-M a@P Up @ Ѝ čP@0T`1@0S0P0S !$0S 1  0/R 0  R 0 0 0X ,   ݎT `: p$ 0R N P 0 *0@0 `V<00@ 00  0 P $0S XXX0 !0@@Q 3p( H+d*40,S8++G-<QHMP `  2 \l @P7tP @0T0P00SP  P p 0 pP@1S Q@TU U $Ѝ  DO0 0PNP PP 0 00  0knh ,,SK-M@fp `(0SSV V+ W @ 1@PP @T Z0S `PP 000 0 R000p W a`V V0XЍA P᭦0@XO-@ MQP d< 0:S5 쐟 0p S P `R 0S 0P R `T0`0`dЍL0RT0``V0:Sd PE-`R Mp`P <"<2 0@@xP0S$).38=BGLQV[` 0m Ѝ 0 0v 0 0Q 0 06 0R 0 0 0 0~ 0 0 0 0 0 00 4{O-DM @`PTp 0DSy P P R 10p*MЍ  T9 WP |P KP W @ yP V ~>PuL R@P rV f @T 0:S  㤉Y |   㙉p0:Sp@40 0nt ,4-4T-D-̡RMPp   10VЍ 0@:SV nS. pAX``V V V@YT V  K`Vڴ Ph 0 0 iQ 0SL@ qP`K00C00:S  h--l-4P/pD-xRP@  0ܙp`V UKp  4E-(RM`p <PU 1P2 0P@ PUPU1P 0P@RPUЍ R TT00@K  00y ,x--D-pRM`p@  P10eЍ qPP P 0P;  0=P 0PP0V  @`  F?'XPP  0@}P P @0@0M_0/@ -\-0D-tRM@  \00Ѝ0 PPPSJ tO-HM `0V0>pW 0P4 fP00pVWЍ@   PP JW@1P T0 0 'PP@T 0  0㛘4 --D-鈠RP`p @T 1P  P@T 00s .E-ܠRPp` (@T0P 0-S T 1P 0nP@TaDԡP@W 0070 T0.G-RM`p@  10#Ѝ /PP R R 10P[J" 0PPVF X ! PP1X 00 '0P0CS0U d0@'P P ڀ00]\0 600CS0 . ִP8 -,P.\p.D-ȠRMP@   00ЍPp @T` YUI R ,,00pI  t4,SpD-䠟RMP@ . R  00aЍp mP`V R pp00`Ia PS IZ`8 l,.O-頡M @pPJT`UTA  0P"Q Q /@T P0 P X @PT ;Y 0Y  Ѝ0 R 008I x @Y02S@T'I 0 0ǖ@ ,,S.Q@-`p@ 0S 0` 00 CPP1!22RP @0SPp@-`@PT@ R 0 0 \  R 1STp@zQ0S  000QD- R@  00] P0 0S 0SAQ: Q00:R00S 0Q:S AQ*AQ:0:S Q:` RGAQ:0:S = @D-ĠR@  00Q 0S 0S@P0:S @PP*QG0P:S @D-4@ B MRP` ;T+ !0pS S G Ѝ1 P 0P  m1'P  ႬP P0 0嗔P }H$0 0㝕 |{.@-@T 00CS 0 \00CS\0 @T0 - (R 0 0 00 p PpD-`젟 MQP 2  :@ @PP 0S 0S0P Ѝpe @\00\0 0PL@ 0 J, PpD-阠 0 RP` L0R qP@\0 @p ȟ 00T000S`0 O-(M PpP` T0 /P  Ѝ6GXʼ< 0ݔ,< 0Ȱ“P@0S  :S ` \X H< 0 PFXX  ; ,P X X @ q     HX00h0p(X˟X+ 0  0fP.0S3  P0SŐHXpʄ h0 S00 0   j    ~TU 00CS0Oʲ M0x 80|0 t0,04 008 ,t7 P< t0S<00p   x 0P(b0SMp00PE 0:S> p$O lR.p0lR(0l$ ~<0S ($0| <d6,0840 b7t0S T 00CS0<0S0@0uK  <( S0:S d( HE8c7< Rt 00CS0o) l8V7<0Sg 0<0CS0 `T 00CS^T 00CS0ڰ  h 1 P) C P=0SňT7@`Vy 07pp007p p地AO 5  S@T  @&+O  0O O ^   O  @T c  0N  @T L  D8^ `<%45 0P0S%   Q     0 YD  &   HX`0d\X p @4 ğ 0 0  0噑P0S+Y! HXpʬ0 S00 ` W \  X YED  I 0 P0H 0D0L 0HP D5 PT 0ST \ 00 0P@Y0SQڴ00PI 0:SB S@N R20P 0@T R @0 T4D0PLH 50S d0S \00CS0T R0\ d\0r  Th R0:S < ~CP5T R 00CS0 d0S \00CS0 ѢU d0S \00CS w P5 d R  1P0S `` % %P0S XX  (/{t\/x//{4//h{O-騡M \p`0WPZ 0:SS iM RFQH0V0; @@pt!X@ @T@P@L 0 @ @0 X00H P 00CS0Ѝ 0S 0S P 0 PVt0   ` `D 0SQ0:S [p ,$h4pD-0P M S@ P  pCЍpR P0S@`T0TPT@00U 00CS0 000 0S 0S P <0 P,0  P_ < /hpD-0P M S@ P  "CЍpR 4P0S@`T0PPP@00U 00CS0 000 0S 0S P <0 P᧽,0  P  /hpD-0P M S@ P  BЍpR P0S@`T0XPX@00U 00CS0 000 0S 0S P <0 PY,0  P /hD-l0d  S P L B 0L   L 000 /D-P0H  S P , fB T00 /D-P0H  S P , LB P00 /D-P0H  S P , 2B X00@ /D-P0H  S P , B L00 /D-P0H  S P , A 00p /D-@ȠMQp` (  0P 0 PR P 0S    R TT00AЍ  ,S0D-<<0 @R ~P 0S  O-tLM R 0   T0 0@T 00P  0 <P@ L0 0(`V Y P  pA ኙPYP UY XP 0 S 07`pPU 0@ 7@@ @ 彥 @T( $0b o40$ 00(0ΩPP@0@00  BR 4A L0s0P $P^00S00CS0g%d t2Spp,0&W4  00x20|t20@,0 ,`!J0!0 BB00 A7y0P0CS0 }W0|2t2x2LЍ|"R00 0C|20x20b 0 Bx2|"00CS0ڄ00CS0P ?rxP@ U:  A ?U. (U! 4@ h n@஭Q 婭00CS0 3!X U@84! @TJP@ (@T  R Ÿ02@0 @| \7 L01 h2 ``Ÿ`2 0@@@ (0S 0CT $R   00? @(00CT  0!0?D 0 ?>1  <P@ 0 @  0`00P00X  _a `H 80 sS   @ v$  0S0S0S  0R@0P0 傟P  t006 h40x0000P```U @T ppP@PU0S S 0S S 0SQ 00 0RSUP00 0RpSp DD-8 \ D0D-HPD 8|\40@P h5S0` DLD-造@| 8d\0S 0R 0R0  0S0SD誺 DE-鄡P 8?\`PpQ0PPP0p S"P. MP7$@p00p0T 0 0S0 @T0W 0P kPpp$@T 0S @T"P  W0 S^P pal DpD-8 [0`PSp`P1$@0 0T` 0S# @T$@T 0S @TP`^0P`S 0 0 p DD-PP0 Q (0S 4Q$0 d5S , @LD-鰠0   ]0F0C0@0=x0:p07h04`01X0.P+H0(@0D$D HXHXPH|D-<<@ 0S, 00n00P HhXD-000M @ 0 @Ѝ XpD-錠M 0 @P Ѝp``PP  (0sSC ~P XD-,,0  ,P0 0 XpD- 0TPS@` 0S pV 0p @2D-PP0 @\ 0 0,0  h hD-D 0.@Გc00S@Z 0  hD- 0h@S   R P @1 P{01  @Q0S P 0 Pi0 @ 0000CP0 0 PU0  0 @0R0 p`@ 0R0 0S 00 @R00C0 hE-젟0` P @T0 0pp00p p  0Sp S P pX 0S 0 ⋳髑0p  K@ hD-@DP   0S  h  d20D-@TPP   0S  U000L  d2D-@(P  0 P᪳00@ 0D-TT0P @P 0 U 0(0   0 h0D-0匠@SP P l0 Py00 0S 0S< 0U000 00 2O-1 1 paM 0@P0 Q0% Q0$ Q$ 0 Q0 0 Q mP 0  0PPQMP Ѝ 00S00  pP00 p2<pD-ࠟM\@` 0  Q( 0 Q 0 Q *P V @xAl @20P@DP ND7Ѝp0S 2,SpD-4 M  @Q00Q  Rp00S 1S ^E A0B8Sb7`_^32[ZYXW,U*)RQ&%$#LKJHGFEDCBz@?>vu;:987o5ml21ihgf,+*b 00^P  0f0CS-.3 > T ໏P  ЍpP 0S 0S1P  ࠏPP  `Vڰ P    QP 0S 0SD0PQPꔿ 2p2 3pD-TT0`P @P 00(0P`  p7, hpD-0匠@S`P P h0 Pı00 0S 0S80P` pA괻 3G- 1  paMP@ 0Q- Q01 Q 0 Q 2P Ѝ0荏q  7(8!8(  lU U ,8@+6 <03D-00 M 0qK Ѝй X3p@-M 0Pkt ፎ`Ͱ 小 @`Ѝp0D-LL0P @P 00$0P 0|< h0D-0儠@SP P d0 P 00 0S 0S40P 0и p3D-(M@  eP00Ѝ4 -M ZЍpD-DDM  @ Pc F `PЍp `0D-LL0P @P 00$0P 0ꌷ h0D-0儠@SP P d0 Pឰ00 0S 0S40P 0 3O-<<2@A yA4 (00Q@Ts| lW<,33,SD-T PM `  *Ppi  ል @pЍ 3D-hh0`P p@T L0  @ꜳ hD-0PSp` 800@TP 0 Pᕯ00 0S 0S0` P p0 P|00 0S 0SD 00 0  <3O-@@2@r <,M0`P 0@ 0Q| 2 Qs 2 Q] 1 Q  0@^IP ,Ѝq 7(8!8(($ 0 0SV =3@@! 0@50  0Pp0S0C0 P`'LQ4Ap$0S 0w@V =@|@l L@30O0 l<W,33,S- M rȠȠ7"/0   0Ѝ0D-0 | P  M 78(,8(0  )P @ P0S 7?00 Ѝ0U 00  4pD-PܠqM`  7(8!8(  `  yPP ԭ@0 㚔P0@0C0Ѝp0$ D4p44pD-``0` P@T H0 pf@ hO-rM`P @ 0Q5 1 Q- 1 Q# 1 Q  0@HP ЍV x<@o?` ??20 È ᜈ[ q  7(8!8(0 E0S0s 0 0 "/ 07880 (( 0@@S @@0@ ,h W<3,S40 m0 jO-0tMS 0S{SP 83 PX00 0S 0S Ѝ 0 0#Pp0S0C0 P`'LQ4Ap&>P0 XWU P (2 P00 0S 0S 0w@ 0 0 P 1 PP 0S 0S0|!0 P0 0ÏPpE0S0C0 0S0C0tP1EW1U P 0 P¬00 0S 0S 0g0 P 0 P᪬P 0S 0SX0p 04 01 #) <50D-霠0@  PS0 00S  0 7?00 0 0H00ꈦ O-\\\ pTM@` 0P  0Q@ Q07 1 Q1 1 Q  0PPZFP Ѝ3R0s 0 0 "/ 07880 (( 0000 00 00ܥ ]<T00000CS0cP-0  z @-@p@000p@-`@P PU @P 0T p 0PRT@DpP@- @00CS0@諫@-@\  P0 R1E-@ Pdp0:S6 쀟 0 S Pd0`SQ 0S 0PQ`dpdp L0R 0S` 0S`V0:S0d0꼢 H|O-ࠟటP  0Qp% dR0:S$ d0S`0`00ê0@ 0 L0P 0p` 0S 0 00@0d0:S0d0ꔡ H|@-@T 00CS0 @- 00R 0000  L H|D-p̠@Q + 0,PP@ d0S`0`00f0L @ 0 0 0` 0S 0S80@  H|-0 < O-ܠ `P 0@M S 0`P   p 0 ЍH @P p 돇 --Ѝ@- @8 @0 ,@@$( 4@O-`ԣR  Q@@ MTP Dp P  . ЍV  0X" @@@@   `V@X40@00Y   0 `V@ 0 ]0 @0 0 0"S {S{ 0NPX@(0PQ`d 00lS RLPV 0{P0S 0  0C0P 00c0  i BR 7 ^<0 0[P``@V& 0  0@@00c 0d0T"S [  .0 00@(0 0b[  . 0@0S0 00 0pP0@(0P`d  0P@ Fᭆ`"ꜝ 6\|66pD-騠@0 P` Q 0  Q 0  Q  0\S Q 0 SQ040n pș 45A-`Avp@P sʠ00 W0A ,H0`QP80 A 70A0(@Q8"H#H`FvD4g0@K-Q MPp`R ЍSU\0r @rT }bTy paTl T\0 0 @; TV , 00 7 7Q500L0C$U 0`&  00  7Q0U#8100C0C$ 0` 00  7\0#8100C0C$ 0W _E _P   @ 0 @  CF_Y`0 S S 0 0 0fT nT 0 00uT tT 0vT xT E0Y 0 @B4 0 0  0UE Yu0 0A-QMP`@' p 0PU@ 0 S- U #\0S@\\ 0 0PE S U0U0c0hЍ\ 0 Pn@0Pc@PEu@O-Mⴑ`#!,0#0 VP0  0  00@ (0^ r0@ 0P8|30`VP 0   00 b 000V  00@   ^ 0Pލ0^ 0 B P0 0 000 0$S [S@ \S S000P`F0T0S   0P`F00 o0S00 0 S 00   0`cPV4  ^0P`FQ  0 0P`Fp, 0pP-, "P( P0P`e 2( H0S*0]S V,P0 004s +L0S0 0c0   R80L  0H04 00Z Qp,p 0@,PL02 `bP6  457D70@-08P@S P0p@-0@`l P"ኄ80PѦ`PpO-PἣQRXM@ }R40S  `0S2   p@T0` 0p`n  D 0{S D]PP  D 0 PCK]Pۄ 0V @e`TT 0(S 0! bR00S 60Q00 0r  b 0 0b0C 0Ѝ D0[P 00Q 0)S ,P0 000`40 U*`0 p00 _Q 0T0:Q00S 0:S@T` 0:S@T` 0:S `@T` 0}S @T` 0}ST 0 0c b 0 `  [ l  v*0 0C 004 1  0z%,@| \7h7E-_M`0 pPP@V 0 00R 04P *0@S00+P _ߍ0ċ 7O-QR``MVPp  ЍR,0S 0@[  "0 `0`PU@ |200 R1PU@0 4 S0 00 8 )TP0#S  SP@DTj{SPU 0T00   *U 0{SR ;\S 05P0 S  `0@CPU04000c0S0 000S "000 00 a000@P0 @A  }S`V} T  b 0000 R00Z0 S`i] 0yR+PKЊ 4577E-蠟MQR`@pP $ R* 0S!  D0PP 00"S W p,7)0 000`40ЍX00 08@갇 7O-(M0 `bP  0  0 Py  0 rPP 0Sn)܍/) 00CS0`U9 U00U)5@T G  0P V0S U  00CS000CS0 ( 00CS0 .00CS0 0S 0 0CS0yv)0@0p0 e0AqAAP0[S# (S 0hsb0Q$S_ 12  @C R 0e0S _1@CAK{SG 00P eR1 `@= 0@`P8@0SP!P2 eR S ` V$ A1T 0 l0 0 0101 AȆ 77O-阣MpR`P0 L  0A S񏐍ji~}|{zyxwvutsrqt0 0GS#W00`FV00SPW X  (0S`X 00CS0Ѝ )X 0S 0CS0000Y 4 4Y  0001 @ ZX0 0X0堏Pp X0 0CX0'0 B ᛑps @R0W W 'T 00CS0 0R`cq41p<  l00CS0Ypp0 B  p '0@00t 8p@-_M@P`0 d`;0S 0@T*8@T@@_ߍp@-@@-M ЍD-AP 00 0R0R  R(\ :\ PP 0:S0)S ~ 45O-@0 MTp 0`  Ķ 0 R  Ri 6&0 XP@/\ Rt 0Sq .S} V  e3 RVJ 0 R 0 ̵   0S0 0 Ѝ$0S0S 0:S0S 0CS0 0`00| N3 0S 0S P 85 P͡(5  `7 `0S0R 0`00 0S 0S P 4 Pᦡ4  pV  e 3PP V @ PRy 0.S sP `W00`000.S[PW V X 0 R* ᥼PP 0 R PD 00CS0* 0`P R   BR 0cP00CS0@Z1 Q/0\S Q 0S 0S P  0P  00`  @0 CR 0&P0 CR 0S 0CS0+0`001200CS0P 0S 0S P  0Pؠ 00PC 0S 0S P  0Pà 00`.P `/0`00<V  e2 R 0:S \Q/Qi0\S/Se@/ R  \0\S/SX @M`} Thh p@-@P`nP 0 0\ 0 @Sp 0p@膼E-``\% 0PMS V V p0@Q00O V< Q6Q. P 0 & m000  BR Ѝ 0S 0SP d4 PT4  @,.AQ Q A 0xP 6P- 0~S00CS0 P ျ0@00 0S 0S P ,3 Pʟ3  @4@fP }0c.000000}y@PK 0 RG V #;<pW /{P7(2 Q  000V\{P'pHpW /{P1 Q  \{P pp ^fPp !`0P@000S60CS0| 0c .000@T `V{|0`0 0S 0SP d0 P L0  00Y| 0c$/u hX\TH8-0S fP -0 00.0O-hDM@Q< @ 8  @P<80Q<0pW_ 7 '0 '00 0 4 0 @0  @<00CXXC4& 0S  $ P 40кP`@ W 00CS0P n@p00CS00PT<00CX W `@V|$0Sy .Ro R <0XW DЍp5  Q QP0 ` Q SP0p P  W C-PMP`= QPЍ @ 0 R& ^@q`mPWU00VppW @ 0RtPtPO-3sM 03 `p`>  0R' |0@~S&  ]P֗U0 @00 0QP0 000 0S 0@ 0 sߍ/PZ 0P000S 0$XP )PP W " 0N00 Z ^ Z& 0PX 0/S, &0 00]0@0CS0PZ 0S 0S P 1 PǗ1  P1L\@ 03 0 B0r0 00]00Cs000CS0 0S 0S P 0 P᎗0  @0 Y尒PW L``0 0Z 0XPe 0XPmU Pth0D-@P0 P  P 00CS0fP  P 00CS0A00P  00CS0 R P 00S 00P 00CS00D 0S 0S\ 1 \ 0  00p 0S 0S\ 0 \ 0  00V 0S 0S\ @0 \ Ӗ$0  00<~Q hpD-P `Q @R  R0 00 R  R0 00 R0  00 0R 0 P 00S  0R 00000 p00O D-P倡M 0` S P\F0 @0041 p RA R* ' 0 B00R0Ѝ 0S 0S P 0 PB0  @ 0R/S\S Q T '0000:S00 S/RpN 8ThhD-PP 0 MS ;0S ЍP0L E-MAԡ`RP` p0 0@S9 SPQ, 00` \P@ ߒ@XT 1   ЍᦫX` 1 1@ 0 @` @ 00@0@0SPQ 00 {PP XP@ 1X` Ȉu}X P0LL0@0@,0TL H*88884D-@@Tp` (P!0@T HJ E-鄠儀` PMU p フP p @V@@LPUЍ r0 S `PI O-TMY` 0  p/" 0$ 0 A Rp 0  2 <@Ys P\V ,B$Ns` 0Pp W PR V 0Ȉ6@ 0|P"00CS0.0%\00S V  " TЍCP00CS0 ᖪ8 0)V 0S  @  0 7   0 @ @! 0 tV Z@\q0 S H 0s00@PI 99 9@9d9p99999O-M0d`h!\LHRl4000d`0\\XTP$Pp000l 8  ,0RV,0 0\D@ (0 pAPhP0<S 2SM hP Q!0`Q!`pGpWL0S Y <P@L 0d0H0S h!R H᧑P0@\0 $0S (p ዓLW0L8 ZP_ WP!0|S PUUH@ D@{P@ Y@@l0$A 1g!<80匑PA5kV, <00R 1, L0Ro@D DP  H0PfpW@040LVd0S\0ST0S,ݍ$OHLLIDPF@P H0P?Q L0Q8d!R P.hQ P#l1S P0Q , pW @01s ,p@W0U , l00h!00d008< 800SR &SM0SIKUH$+ lQ $LP$$0l!0 8 $08(wP  P0$P0 8pwP P0HX08Ѩ8dQ L═P8ƨ 8 0vP ܏P0L`00>S0ß>ST0A @S6P0SPP[ 0@S 0S11Th P8 $P#01S0S0HWH P0$ h0t2!80P $TPQ>S |Sc0&S0S 0W 0HW ( p(R`8 08Ÿ>S<0&S; \0S H$0 \ STX0S H0$ XR0P00S11\h X8 FPH U T0SP0$S P  $THT0SP@$TPd0S2`0S`P0<S 0S11hd`8  PLV LPh 0S0S1Y0VTD08!0WLdP嫏E 9:<:h::A:8:A8E-@M0`PP`000p0 0 @aPP"9 V 0S6 X2 \'   0子P  ЍU - 契P PPTRP@@  0   ; :;<;\;|;0G-鼠Mp `d@PT no`Ѝ PV<<<0 0p \: ;;*-MЍO-\MT `P@T   PUY@pT W  PV  PY @TW}0S9ʼPU @S SESh SV!  SY ߃SX   X Ѝ l R1PU. V%  80Y  S@@TP1S0!0TT1T  0` @1S0!0 0V   0P  {X X Z rX  0S` p^\\\0 X 0@d9 4W;;;;<(<0!"#$%%&'()*+,-./0123456789:;<=000000000000000000000000000000|0 NNNNNO OOO$O,O4O!"#$%%&'()*+,-./0123456789:;<=000000000000000000000000000000|0 NOOOPP$P0PLPXPpPPPPPTOPQQQ4QHQ`QxQQQQQQRR0D-88P 0S0$@| 0000 E-` 0 PR0S+  Rp0P  2 P00  P ۆ00Ն @"d<0@000004 D-̠ 0@PT 0S 0@ T D00CS00` p0CT0Ž⎰V W D( 0R0D-阠 0PR0@0 S 0 @RU 0 0D؆0S0 P00 _@ `R@-@V00@ Q 00000CS00SD-آRM`p   20YЍPU 0@ @ݺ \ @T~ 0\ 0:Sn 0  P$PH 0R  H {H wH1$ @ 0@m`H 0 1` Q @T4 0 S- aS D cP00S S0S PU @T0  yd00  0S@.P0 S '@0 0S f`d0 0@@H0 0 P[ R40P RR0SHSO-@Mdx@ p $ ^P4@@ d0S<@yd 0 0_00d$0 08 40$_CP`qQ8000  8 0RB0S0K0,40$ 0ACP`S0pW$W ,P P0S bW 0S (S :S 0S R 0 S$@bPP0 S 0$0SPMW a80Qh04W@Ѝ<$ 0@ p$ ,EQ00C0d 00CS0@T 0P0 00CS0*0S@ $4PW(A(0V,  0zbP800C\0S0aSaP 0; 04, 0@" z0S000 S\2 0  " ,0@Hc80 0CR, e0S,  `0aS,0 0[GaP 0,,;  0 N,00000:S#1$ 0 O0@T0S)S <<1<$  0@a` }$ 00` ., ,o40$ !080 @0 0$$ <@<'0d|d 0<@0000 `SPST<$T@T\TxT,STG-pd0@SPP#TM` 3 {b00 $+EQ  d R 0S  R 0 0R ЍR  P0c  ᷾PQ( ,SO-H MXPp d0( S`` 0 Q r 2 Qc 1 Q_ @#TB b00 $+F P  d R 0S  R ||1 0 ЍR   `P 0S 0S 0a 0 GPP 0S 0S 0 0  sPP`0S0cPhs P}<,SE-РRMPp` % Vp@$ 0`PS 0Ud`d0 /C'HsP@ dЍ4 K 0 0V T UD-H 0 VP @!(0P@ Q 0D-,@  0P@ QX 0K-M0pP@Q0S 0; UP5 00P 0Sy 00 X; 0  `\`0V0P00S 0RM`0V0P00SP 0 ;  0PU0P00X$ U ``` 0Q0 ` ``` 0 SP @UЍP  0 0 U 0 P0 U  @ P 0 P00 RE-XX0 P   M`\(p@ , 0NЍ X(UO-p0(M0 $ 0Sğ 05P` (Ѝ  0㈱P` 0 p @ V 0P$@ L(R ^ 0  }  0Y"3#s`@Tk 0 R X YPH   0 AY 0 T `Y3 #P@ 0 0CS0 Y垁 ~ 0S 0S R 0R ቁ0 00 ! XP^P@    0|@X  0t0 00Z0`0CS0V 0$ ` 0C\ Y  0 Y 00 0 0 P Y R- 0 00 0Y0   P 0  ^ !  R 00000   00 00 P 0b000, hUh,gP\O-騡娱 ` M\Pp@ ; \1  p0DP@ Tp T Ѝ8^802P࠱2ࠣ2P0 1`4 0@0@( 0 S0000S 0 0S l 0  0R0S X\xURD-ԠSM@p` P SЍS# S 4T 0 00<V < <V T0T0q,0(0ЍD<( HUU\U(00CS0p@-` P 00CS0"@T 0PS  R  R 00CS0 U@p@up0D- 2<@0CSP 2  2SlP0 }P U-0  0D-DP@ 4P @0 000 0 -$$ 0 000 0  00CS0O-0<pWM` @" 0 2 @R 0  LPP0Ul 0 00P LPR R R Z0 00pW 0'Pp"LPP 0S 0 p  L P PgP 0 0Ѝ0 SLPLPP 0S 000'@'0'Ġp8 0L0R R gR 00 S^LP0 SULP  x0@-P@e\ 00@C-M@p $ @T``PA 5 0 0 `,@AЍA-@qQ`( 0S$0S P 6(006( PD- M@$@^#3(`^Pp,Q 0(@p P$P  P ЍW @ V0@-qP,0@0 00 \ 0(0 00@-P@Z\  0 0@\0@-` M p$ @P $T@Pd  0PP Ѝ0@-PM @ P  0 Ѝ0,0 (0E-鰠尀P 0MpQ`@ Q 0P@ 40 0R40 0S0@ 0Ѝ0S< E-蠟MP pԀ  8\ G0`@S   `RV  ,0@S  0 0S V 8 Ѝx x}t)E-鬠M` hp@ d0㟱dPt00P PX@ [ d0f㊱0 0P+Ѝ0p \W 400CS40- (40 0400   - >PO-PMH [pj#PQ 0@S |0XZ @T1 0S8|@000,0`$ Q? 24 0p ᅃp? W)|x 0(R40 h400CS40}@p0| @T0 @Z| [|`Ѝ4x }0 S  ; `0S YPT T J 0| \0 @Z|`00x$ W\@-@⵰(P@||pD-||[ "0`PS @400CS40 `|V1 0Sp p@-P @1|@1`00 "Q l0" 00 00R000!R0 00000pp@-!`@ !0P0 !P  0l0 00CS0, R0!00P 00CS0 R0"00P 00CS0  R0!00 p@-@P 00CS0P 00CS0P 00CS0 00CS0@|~p@-1@P0FoE 00\0! x0\0 0 0`01p|  0x0|WZ0 00@-@P0FυQ   Q !00CS00104x0S x| 00{ )ZD-@帠0 0CS0 0P 0S S D{ 0S 0S\ @0 \ {$0  00( h@-Q@F?`pP0 R  V V @_{XPF? 0 Yz0 @- @0S I 0S C  ;J0D-0QȠ00 @ BR 0S S 00F/01 0{ 0S 0S P 40 P{$0  Pp hpD-0张@ Rp0S 0 `00 000 9000ЍP0 S|0R@-@pxPW* |`}V WPUcUPӅPy`XxPx`|Px00RzxW XJzp0x0|0`0S|` W|`@-0@S S 00@S*z0@-@ML0S SD 00"PF?R0Q'1SP0P 2lP 00CS0Q101Ѝ0p D00CS001_0 D00CS0RNyD-AH`0 S20CS0$q$PP 0 @0 A 0 0S 0SP p0 Py 00@|pP \p0 Py0  Q0  0S0 0p hp@-`@P @R I =p@--Ѝ0@-"P@R 00CS00B0000D-Ԡ PP@U 0 | l\!Q000, (d0 @'0@-P@!@00CS0T0rE-|MP @`pP P 00CS0K0A00V Xl` ЍP 00CS0401@ 0P 0Q ] 0Q   XD 0S   101h xO-䣟XM  `,(0$P; R@0<4 0 @@ <0R  ` BR  004Q ,@ mPQ  0!4Q,0|S(0 , 0(0\,0 0R(000SP XЍ00CS0( @P (0S $40S  "$Ÿ d00CS0"0!4 0@IP $4 R hh1$d0 uTPp@0D80p 0p P 00S 0 40SZ  @8 4060  400S $\ dL`0$  04002 `P5 ^U@( P 0I 0U  j 1 2/ 0l' 0  pD-蠟M 0 P`ƖP   R 000 000CS0 Ѝp<  0@@P   0 W,SP0@-@P u1010@0A-0pp0pMppp`P-!8^S !8]S@ !8]S -Sp-0@#8]Se@evW00^v00 0-P!-P]P@Q !88]S -R#H !-Q 0 A00j-P!88]SЍ]R \-0P#P 0 D$  A 0#8C$ 00 0  @D 1 @ D0@0 #8CĠ0 @@  %-P-@u0P0-i@-PpW`!H  04S \W W 1 4S0 4S*\0S'p@-@v0S@vO-ԦtM0pR`@ 0 pP01P   0  S r ,p0 #8@%S @0 0SV` V`0S`P 1S\S PWutЍ K0Wu  {,p0 #8@%S @ *SC STr000 0SpP%8SSr000 %(hR LR 00#0V00S ^p 8[0CS񏐥c A -l ^ 0PRW upU01P 10 1 Ntp,@ +t ,,3 0HLiUZ  0S +pP %8@^S @! %8]S 0S +p 0"(0]R 0t7 0S +pP 0%(@]R @ 0S  + 0pP@ @ ~ (@ N+1t 0LL R   @ |+ 0@ @&lR$ @0lS@  @m+ @ 0  @R  `+ 0pP@ @ 0D$ RP$0$S@  @H+0S 0@ @U J^00V00SV U   ++ 0@ @spU XHXXXXXYP`  0P  < `p 000CS0`᜿ƾ`0PWAT  F00CS0`0PU߾ꬾ 4 X%*|rX0'(P%RXPe *R RQ~200 '8SQ~200 '8hS LS '8[0CS5/3210/.-'%$#"  (0c 00*,@00@,@00[ $ 000S  )P| -P 0S 0S $[0@SFt|T`0[S  )P| -PTT0[T 0 S  `fy,@0T0@0,@d@[XT`TX0S L)|P!1P T0[T 0SUTV fC, 0T0 0, #)0`F| Fd0[00T0 @@l P0 00CS0T`$᫽@ P @Y,@T`@,@00CS0@ᔽ=V0[00T@0 @5 PT` 00CS0u  )  ,  , H nPH HP9$ $P 0-SHLP qP@ 0S P[?Ͻ0-S 0@c$i@$f $ i @i0@$0s0i$i@$@@XP  L(|rX0PXPFlSDXP0lSP XP<(|rˌXPX0X @O X+(X0|rPXP Y,S9Z\0E O\H0$S|rP XP (H X0|r BP, XP (00X0|rP'P| +PG 0SH `E-騠QP 0`@T 0 p00Up0p p0Pp N0pa@PP NNP hG-Q p(0@`V 0P P" P*0 npX00@ 0  N0PP@&`Pp 04p p 0 L hH0@-@[ Pp 0 R  0S R 0S0bR0 0P  P0 00b'0000@-@P(  0s 0S0 00 @-@  0s 0S  0@-@P  0s 0S  U000p@-@P`  | 0e \  4Pp?@e@P  @i pD-0̠@S`P ) 0S 0S0 0PUU|0P po M 00PpVP =<;:9856434HX p #@㐀J100  %8*S &8P.SP8P J100 a&8*S &8 hS, 0 4  lS| D!X&8iSd0 1!ap`p&8xSaw_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      #}|{:l\ yllh l ⥺PFO "d0aP(P00&(GR; AER8 HP@U0P Y@\h 0@T h(Q 00CS0ڐ0T iY@ h@R 0TX0P@0X0 ἶ \O# bXR lp ⑹PP@mHD %0Q0-00@@R#00@0S000<\ 00Y+00 R!8Q1 ( 0PT/ #p LI &a|4.00 @I0@m8I@ >80S R  B0a@0(@W,\, $ Q00S P,  qP0@S@ 0 0(0 ,Q~a&8dSz D R &8oSj gXS^ &8X0C S$z"!  c ]Z40SR0PUK,\E B]0@x00娶08P-Sx0P0Cx0Q x 0R Ѕ x0 0Sx0 @ @0S   00CS0KĵI x0 0Sx0@ x0 0Sx0|r0i$@@&8uS@ @oS40 P@  SPPP $P [G@ @@QD@&(P0$oR0SPP`B F q3  @_,0S #\ 1  G 0 c 0 %F P W0000 0 0 L(G r80S 0V  )0`V@@@@PU  H 00CS0 O 0`V  0`V0PU 0 z  @_0 F0n,Q Q AeAG0 ` BF110X P4BPEP P|PN FPCp  axSD  0a0C0T 1  a{1BO l ẻP @&I0@00, 00CS0KዴH|P,  ፸P 4PU|0|08O#8$0O;,  ⣹P0|04@T ~Y[4WD[tpH[l[[BO l tPF HᾺ0@ 00,T00CS0EBO l WP)$Dp@@0l0S @&(Fpua@&8lS0wpjaP@,Pnpaa0@40ed XP0BUDl 睷P0pSIXa@XCT@P0 Fp5a@2p.@8dX 0ARD1l kP0pS0cP0HPXa@XT 00 sFpa@< D 0@0T L~ (0SF 0$SpLXPP@UT `h(0\0g:A- M@`pA0 PS @   0S 0j0 0@0CS0 ЍL -- 0ЍK- M   0@p000S `P%SP@ 0S 000  0@0CS0 Ѝ0%S0 xS񏐘~}|{zyxwvutsrqponflkjmhnmlkjihgfe]\[ZYXWVUTSbQ`ONMLKJIHGFEDCBA@X>=<;:98765MLBA@CG-,A*)A'&%#;! 8[  P*0S Q*0S` ԆKPε ̆0X`A00 #E@P0`0`v)VV%  -- 0Ѝ-p@-@0` PU0 p@ Ѝ?Y00CS00%A-`Pp(  @P00T 0RAgf`@0@pU *0SC$ ĕ0ĕ\ P@:000`FD-P唠p ` Vf@`0 `0   @e0 @ 0D 0  \ H0D-鰠P 0@R R 0S R 0S0 0e0 Q0 00 0 괍 HG-0MSp  0S 0S,@T` P0 @ ~0Te0@PT00Ѝ0 @ d0PT 000 eO-즟MpH0SPX0L 0@ A}CFIOtwC00 +Tp -Tp@p 0T1 0XC00  00DO p,`PE .T p iTITp nTNTp D@0hT0\0`U C000 `PE0U0^00S 0SP @0R0T00Sc D\ 0S 0SD^VSTQ L Po jtßH @20@X ] W T0 R<0SЍp@`@ D^ < R0XP@ ?[ =@ AUYp0 <0?[ <@TX XA <\1@1A@PX6XY3?@ /PX0S1@P ^   s  P@00p }?@<@p@0SP ݷ PE@ 1P\P 0i0 < R p  D<0 S@XP ?X 0@ qAUY0p@ <@;?X <\X0 0`A@|p ꠋ 3,S\<(\ 0P苀00 ?X H0O@ 1A8^ 4 R`00@ 0@>X 0\S0 A0 00S.@@81D@\34^00O@8 0OR4\@1@P ^  0  0s@P@0 =00` >@0@@\`P ?` D1@P \440 P 0a000@T `  C

$@2<T  Pn Q  @0( n@,0P (@@00dp, Pw@^?O?OP P0@0@`3 P0 fxǸf@@+P3 X0T@ 10D0SHP\1 0^0  +@ ?0 ,^ 00,0,pn` HC  [> Rr0o0T A00  P\ .T eTETJ p7 p50TC @00 00D A0D0S70Da0D0S2W0D00P0S+ <@ 1T)X@ ?X ?TY0p@ <@~=<\X0 0?0 @0@pp  B = p pXTxTDp`Pp BTbTp OToT0 0p Dp`P 0T/ 1TPQ) < R(0X@ ?X S?TYp0 <0=<@TX D?@00@pp  eB w=Dp`PDp`PB0TDp`P 7@00  P R 0D<@p 0  @<, 00,0 pX e0T(( @00 X (0P 0R(0 0D<@p 0  @<,\ 00,0,eTETDp`P+T -T ?00 0@D @, p$p? 0Dp0`P \: R1Ѓ000C1 0NTnTpFTfTp ITiTDp`PpNTnTpITiTpTTtTpYTyTpATaTpNTnTp(TDp`Pp ?00 , \00D0 S a0D0SW0DA0D0S70D00 p"3G20@)Tp`PDpPQHVP&HRO-M,ءYP`p l  0d 1 Q]10 0@ P>XA0S>;H1 U  0 1A  Z< Ѝ0 0@ xA0P 0`T5PU`Tڬ0P LD@T A @Y  > 0@$  00 00x x E--MSP @` V-00V"@epdW@ ; 0*c<XЍ½n>x 01Ab>H 01A, 00cVV> 01CA@v t D-ࠟP0  BM ^p`ʸ0 ^ሁ G 0-0 @ \W、Ѝ -P0 N- 0$ -0|u  |  @-<0P  ,0 -@0O-Ձ m-`0M  0Ѝ <# < 0PbUP[Pñ0 pP =`@z?e=0P `o`TAџ$p1, 1#t1$1p11#t1S1A$- U`VZ<2P@Y5tPU@+?2P `@V5`PU@ P  ? A0 00b`CCA1@Y5?PU@0Q/ ?;p" VSAD-  0  c Zځ6;4;[N+;);Pa 0= \? W? R?k0IQF?AAt O---쐤xMp - ?000  xЍ½h`$0- ?0 0h0S t0  $\3P 0 0 -'=#=AD-4=p!R0  00H b>d3P@[5PU@  >80 0? @> ?X ? ?>2P@ R5PU@( > >  9 :PT  %? 00 0  ?  0:40  P?  ?: RO P@@ 9 : 0S" TP000 10  0F: FP00 > f:PP P00R00S > O:P P00R00S  >  >  > 00C  .>g  )>> 0b0b00b0b0*00 $@xp | 0P  \P 00   00 0c0\0l 000p-`PV00-p0 D- m`MP pU:0O00\5  a@F=00@.;P  T/џ;A$p1@D 1#t1"$1p11#t1S1TA$050C0Ѝ P0ό- ;,`$@A?Ak $ | E-4Bm .;A;AD-:p1B0\pW`Pp10%O@/pW``Pp0焂1` 9 `b B0110 ^;}~AX;ADt1Sg"0P2p0pWѣQ1pP@p<pW@Z>p@p>W ;b4  lt1B #;HA;A;ADt!,1 ;8A ;AD-):p!0 90 ` :#XA:AD-:p!0 Bp 0z@P@$@J@@?@Ȑ<@i | t    $ x \\0D-000P c\ 0@V8PU@Z0f  -KpD-0MP` DZU 1@   0Ѝp 80-Sڠ@ :-/90 @l7T <d 0:;Be l,3 E-Bm`Mp {8P1P P 8GH"00 RぁЍB `00e@k;T* I< \70 P:0@S J'џ- <: 0們!!R@TAZ7 - b,:0S、d 0,: 8Ahd | G-Bmx MP !;7pG 8@1p PG ,@ 0``V  ;0@S J:џ- 90們!!R@TAZ - b9^7넁 ЍB : 0f 90 S@@L7T 675<Ab | D-Bm8M@ :Y7p `7 71P P7p0`Q ;0@S J,џ- 9 0們!!R@TAZ - by96넁ЍBa 0w9 O7 ; NAXa | G-BmM Pa7䐟p 0 `0g@C`:T" >;0@S J$џ- :9 0們!!R@TAZ6 0焁0c00 R㄁ЍBd 0)9 7A` G-TPM`- p&0! 01 -C71 Pp @V5PU@ځpЍ -+70們p ``01A -7h0 Pp @V5PU@A -70們p^ [pD-造M ` ;l4PR\@  b e8 4 8Ѝp8?] | p-锠`PV hN00P`a 0 pD 0 pG80-  P`\ \D-`LPVp  @}Y @7@D\ ( @-@0pQ 00q00_YP`U0 !R!P\P`PY- R1P R- [ 4 - Z 4 - Z @ - Z @ 0D-44P @P0000tY00tZ ( ,- 8P  (0R 00Z Ϻ\D-РM` pP0P@ 00 0 P 0\ `0 T0 H0 Ѝ(0 $0 0Y xl0D-``0 P-P@ 0 0@, rX \ D-XX L@H qT P 00XP@X \ @-M@ p`Y60@ P@@k62`40=L\@ N  @Ѝ?BA-P@` aS*LU It0S!@($@(204PS$0$0   @0@0CS0̟00CS0 ڐ1 0|ẟd`\VT1k~L10M`  0`/ P`) 6s0Pr000@@ w000@u000 a00 s s  s H L00(4H ,]|]]c]^tHthO-Q,M@P p :Q ,ЍR 4 0&( $0GsP(0S X`4ğ 0 0  $0 0 %P  0Sqrs(0`V̟T!+S0` 0@@ @ 2 垟3  0`;P }S 叟@  <㾈P Pß P  0@P@ 0 S 30S  0P`   0@'Q 00000CS0g@Sd`P 8SX [R  820 &H 5   \^\p^(^t_O-Q$M@P p :Q $ЍR 3 0\$ 0pP 0Ss Y `t3tß0 0  0 0 /#P0SRST 0`V]T` P0@S:0`/ 32@ 0@JP Q "h@  0@P@ 0S0Z U e.P 8@0@{@  azR  10#g l` 0`P`H o0P 7+ @o @zp Prp  npq eph \p0|^ Rp0XT Hp0 A @: \^hp^_ttHc0@- P< @寅P T4 P 0S P00S P 0S P00p@-P` <㊅@T0 O@ 000  0,04`0 ,040p`C-p@P <hP`: M0@4HHP 1 0S  R0Sp!R 0S  R\ 0 0 40 00 0CS0W 4P 0 P,00,0O 0S 00`G-PM@p`   9 10S `Q0%00 i ` L1@ 0P(00C000CS0ЍO iH00P0OE-P    V    000 0 > 0  z03 @(\_d_O-̡(M`Qp `@ 40S= d R `P 0S0!V00S0 1$ PP Y 0$ 0 40 0 0$0R 0S 0R P P0P0V00S0Q1(Ѝ@0S P0 0 0QL T 0X 0`0CS0NL>1 O-($MpQP 0 p8 P5 1 2!X0 L 1@`X 0 0 A00 0 0R @ @ 0S0S[0@0S0W00S 0R1 W$Ѝ ^0 0S `0 0\0- 0 L  0SL0 0HP0T  00p006X P 0TH / C- M(@`pM P+00,00X 00p@3N Ѝ00CS0*NO-@xMp$  P `    Q Y 00CS0ލN00P M+P 0 000  R  0$ R Y  !0S X0  $ '+hM K,0(Ÿ 002  B!0@   (0  0 !`VP( X00$ R 000!,!000=0`00!,!0SP004 0S L`ᔙ00CS0 ' R ٘1t !`V )Pg0P0_ HM], $4^D^<^P^l_O- M@ pP`0    Ѝ * P0 S 00. 1]WX Y0 =  83 .@& 000 0;P[ X 00CS0[ 000 |t   @ L @8 ,(0h) _____T___@-@P`p 1S0!0 0!-L!P  `p E-TM `PpL440@`@ @0 @Ѝ& PK-M<` 08@pK@TP 0@A 0 0 ` PULЍe@TJL@-1@SB S 0 S S0S) ! 0R0 0S R0 10CS1!0 00!0S@!0S 00D-鴠M P  0 P`pP@ 0SQ 0S 0 PP 0Ѝ%$ O- ȥAMp 0 ,appN0Q 000 p00(Q3 h 0h0 E[P 0  @T 0 !AT@@`T 0 !ATW"  R Wp[00C00S  0 B 00h LAߍ$!=01S 0400p: @ 0  % 0 008 0S0CS0v0 00 > Sf \SR 0I M0(!B%@  (Q      0 00CS0 00CS0 1p01gfc0(!P42 00U S 2 0 1F RYQ ` (1PP @ p WA[ 7 R ` (1PP @0p0fW9 0PS $(S 0S@ R 0u)S0@c  a $ 0 000 (1# ___h8c_H 000CS0HJ-M 0 ЍC-M`@0 ```0P4Pp' DHgL @P 0S 0S0 ShQ 0S 00QR 0 00 00Ѝ#-M 0 Ѝ0@-M0  P$@P T P 0S PЍ00S P 0S P-M 0 ЍpD-霠M `0P < PPcP@ 9 S 7I(0@ 0,0  0 Ѝp'd dp_0@~S00P000@~S-P@#<-< P"-@0 P@3@&<-<@-@0 0C-@P 0pU `@:f 0PU@:-QQ0S A40? 0#B Q 0S0S?036? 0C0A40QC-@$p  0T`P *0SC$ ŕ0ŕ \ @P:0f 00n .&-((0  Q `@-QMP@p` 0SPE@U`Ѝy@P`0S SC$ Ǖ0Ǖ0 @`Sd0@-@MP0SC$ ͕0͕ 0#U @PЍ0Jp@-@M`P 0SCĠ͕0͕0#VPR@Ѝp/ @-0M@SC$ ͕0͕ Ѝ@ P :0SڿSR@ \10@-QMP@ 0SC$PE ͕0͕U @ Ѝ00@-QMP@ 0SC$PE ͕0͕U @Ѝ0@-`M 0P@ 0 pS U00ЍL% 0 A-0MSP` 0SC$p ͕0͕ 7 HM0W %P0S0h0ЍEPpA-0MSP` 0SC$p ͕0͕ # H0W \%P0S0h0ЍPZpA- MR`@ RB4p0͕ ͕@  HW1 0%`@0S SC$p ͕0͕  X0W %`00S0h0Ѝ`p`pR- 0\ RR c \ R\ R  `0S0S p@-RM@P`B 0SC$ ͕0͕0 SC$ @ ͕0͕ P8#8"P`FcQЍpp@-RM@P`B/ 0SC$ ͕0͕,0 SC$ @ ͕0͕0P(#8"S 9@40 2@40 8#8"Pc0S`FЍpqn-TT0  !< 0 20 0@;L8 8# 4-TT0  !< 0 20 01@C;8 8# 4-xx0  !` 0 2T 0 " 0L08#R 8@;L4 4 04  04R@-@ 0 4S@T`R@-`P@ 0$ 4RP 0  x4 W`V@`-HH0Ƞ  80 ,( 10P 4>-HH0Ƞ  80 ,> 10P$ 4-HH0Ƞ  80 ,0 P 4-HH0Ƞ  80 ,0  P\ 4-dd0  !L 0 2@ 040S1 0 S 4?-HH0Ƞ  80 ,0 Pt 4-HH0Ƞ  80 ,( 10P 4?-HH0Ƞ  80 , 10P 4D-xP@ ʃ#000 $ D0! 4 02(0 !: S2D 4-HH0Ƞ  80 ,0 P 4-HH0Ƞ  80 ,( 10PL 4>A-pPD  400*T00S*Te ?TPp [T \T X$4RpP&0@H T 4XPd7pP]P X@)4-S T4]S 8PE 0 4]S 0 X TVPPVՅՅ  H h4*S @S X-[T?T \T X 04 S  Tp eP 0p 04 S  04 S H 0$K-M$pPၰU  D*0T0 W00S%*Tr ?TPp [T# \T Y  0$4R pPЍ0b0@H\T PUY 0Pd; pU]P Y@- 4-S T4]S UPE 0 4]SPU Y 0 TVPPV ՅՅ 0  H0 h *P U$ Y@3`e[T?T \T Y W *0 4S  Tp g 0QP Wpvt W*0 4S p W*0 4S H W\O-@M<`@P p0`T*!000 @T 0{S`@ "Sp@Y`T *0"S| : S S1 S/ @T:T T*o!000 @840 \@00ЍV [  W0h0 [   0h{S; \S  00@C}SV`F¸ʷ h@T *)!000 [ `pV *!000 V`2: 0d @ |V`W  h@T * 000 [ ܍`pV * 000 V`2:0 0d @  a,aLaa@-PM@`Pp0 \S  p0 @DT000ЍN0pP c0`C@O-8M0@С`T$ 0 P_f AA0`@0pS. 4 00,( 0  0$00PP0fpc240 R X (0AS 4, ,0@P0`0S 018Ѝ ,4,00@ A$ R X w A? 00 0 S@a G-dPpPM M pH `U@B 0{S? "S= U*0;S  S  0CS  pR@:XpepЍ $S\S [S{S  }SX BpCZ R 0 S  y0p pp0P0 qPQ@-Pp`@ \U #R 0S {R #R U \ 0BtSxrqponmlkjihgfedcba^_\]Z[ZYXWVUTSRQPONMLKJIHGFCDCBA@?>=<;:9876543210/.-,+*)('&#"!"!     PU}0g0t00n0v0f0r0\00 @P_\0@P`0 X@{0U0 0U0}00`A00{ }0 0K-PXM p 0PU` @PU`@@PU@  U1   P@U`T0000D Sd@XЍ?00@-M@ B0SC$ ͕0͕Ѝ K-`Vp@`V@?Wp `V X000H0 Q|000 Pm@Tn0\00  T0\\S @DT`V  00O-ܢ(MX 2 0Q 0S 0S 0S  X X X@p0QP` P0@ XT@Z? Y  @ 0 S1  0Q`@T!P~U 00 @D@`TpPW~U00  T0W\S @D@T  X 0[  0 B0 00K0@P 0 P0 0 00(Ѝˊ 0   0000i^ XP$p ` 0 ^$ @!0@_ XTh C-PMp@T@ `*0T0V00S,*T ?T [T6 \T0 RB40͕ ͕$ pRB40͕ ͕XP 8#8"S Ѝ y@H sT PPjX  i0!B4p0 @T]T LX  X0!B4P0 -Q #8"S]Q0 S 0]SP dP0@T X 10!@4P0 "#8Q(("S"S:S ZXP  @4NXP @40AXp  @40 RB4P0͕ ͕p2*`*V @VA \X  0!B40 [V?V \V X4 0S SC$@ ͕0͕&0#(8#R 08S 00S PP P@4 0͕͕p @0S SC$@ ͕0͕ 0#(8#R 00S@X  i@400S 0  R@-p`P$ P 0R = 0U *0U0:00  U=@u @ pC-QPM   p0 P0  R0 d=p@`0S  000 `0 0  0 00Ѝ=@.p@p@-0PUPU` U 00 0R += 0P0p<@ @0@-@ PPO= 0P 0p@-@P `R00  0` p0Fυ S @-0 pPS@"=`l0S S0`0 <0  00F/01 Pp00r<00D-< @ P  D4t)p)- D-hhP@ (M` Rc0-Z0-ʂZ0-Z f(Ѝ p0 0S-000S @ 0 pT0 .00@@Tt @P000P @@0 T@@ P@.0T0000 JT @@T00000J @0P0pS @p.T 00 0S00. 00 0  @p| aaaaO- M@0Pp+@`*P` 0 Ѝ0 P  P0SS0t0ʊ0 =S 0  q0)0| b0bQ@-@ 0 {S 0 S S S S R 0R\S R d0 {S p@-QM@`P00S T@D 00 P.\e\ E\ fЍp0XSxSP@A fPO-ءM@  pፊPЍP000 ជP@T= `0   @D@P-P+P@DP@0k@& P+U-U"  000 $*  vPP 0 vP +U  0  0C0Y ?@ PP0 0j4 P@ Pb\bb0D- ``0 MRP 0@: v@ Ѝ0$-0 b06@end`E-TT 0@ MRp  0PeS T 1 0 Ѝ`V  5PVV0+S-S 000  uuP0-S00c0 0S 0S 0 0(PbbIpD-鼠`P @00 P-Q+Q@0T p00 @00 @QV  ிp\0@- M  P P@ 00CS0E  P@ Ѝ0跅D-L F@P 897! "@-@l @$:0@-0@P0(: 0PS0 PD-P0尠0PM0`p  :/@9s P0 p00@ 0 `Ѝ0(E- 0唡@SkM` 4P,P kߍiP\ @ 00 @00000  0S 0}33 0pS @ P0 0 199 3& - p*(b-0  U8` -  ` -M ᆅ0SЍS:-0 TO-8Mh @崡p\P p@` 0(SK 0Sx T@ 0 0`0P@  `0@fP@ 0 @0V h0\`@d  0 @Z@0W88Ѝ\    \0{8pe@T0q)SR@e   0 \0hLO-XXğ ` P 0MVX ` 0( d@ ,T00p0S0S3 V X,0 S@)RU 0S 0SK` `($@  0@P@. $0S%0L3 0 @0[ pW `T @ \ 0 @@0Ѝ}p`` 0 0(\    T0cX`0(S `V[  L@f0D,`7@D   00 0PS 0S20 1 @T' !,0`PP0`B `0W0@ 0f 0pa7, ,0`,  S@0 T0,@T@ 0= :$0P7(0BQ2 `P.H0S [ `P 0 i pW 00 eσp|hhLO-4M\`P  0, d Xp R0S R@0T0P00S 0  0S@0T0P00SP0T PQ00X0S0  P^ \R0WO 0:SI 0W\ 00<  mP0'0S3 ,0($  @ @k,0S Q  @),0X0 @ \\0000 4Ѝ1  X0 1X  10:S0\W0P00` p@SV(P 0  0R/ `V P@ P\ U  00@S 0 @0 8k6P PU@ ,@T0[ OP\`0 0 0-000  0p 4`\DO-M8P吡 H0 Sp0`? `3 40S 0 00@S 0S y 0 0@00 @ Ѝ0,P@ 0  ,0r ,0 @@hV  `V 080 0057  ,0   ,0PLXD0 - P  0S  <0D-ddM @@Pp @`P  06ЍG-崠MX`@p ! TP PU |@ @  0@ @P  0 ЍPtG-@ MQ` p,0PR  R  RP  0S   10V00S 0`0\0 00 Ѝ|000PHDD-鐠RM@  P l00vЍ0̠ ]P 6 <\ d-M0 Ѝp@-`MP@%0  P  0S  ЍpS0G-锠M4 @  0@@ P`pP@  0KЍ0S 0@0ᇀXO-pࠟMW`@ 8+ TP PU! @  0@@ !P@  0 Ѝ0S 0@0QPpO-PM0` <@p0 0S) 0 0S  0SV 0S 8  0PPS R0@00R 010T00S 00CS000@} Tc 0S<  RTP.0V0000000SV 0S 8 L 0  @P 0 0S 0Ѝ;0S0C000CS0@000 0S 0S P 2 P142  @\20 0P  0@ ,2  @o T000 0S00CS0@000 0S 0S P l1 P3\1  @R 0S 0S P 1 P31  @7;4XB 0T00< 00CS07 0S 0S P 0 P3p0  @#  M H0 <08 0 C A @00hHTXO-ؠMX`p@ 8) TP PU   0 P@  0 Ѝ< %kPgR3 @  < @@PU [ @T   Ϡ0P` @T ,Ѝp}P VaI]V L> 0DQ  0  XPP 0S 0  P@1 Ǵ1= 07VD R 0 (Pz 0S00  0S00/V =D!Q 000F S< WD0S<YVI @4[@ ,<00 S0  0 0 < P t , #P D<0(0 00 (0sS@@V [@  NOP, P40@00`V 0  0  0P L0 NP>P08PL@< LLPm 0 P(800808P0\00C000CS0A 0S 0S P 00 P*/40 00- z*00C0  BR 00CS0 0S 0S P 0 0 P/40 00`nz 0S 0S P 0 0 P.4 00 Wz0 0S:z`i00CS000CS0 0S 0S P 0 0 P.(00 0S 0S P 0 0 P.(00@z<cP# 0<,P 00<h  \NP 00CS0r 0S 0SP 0 0 Py.4 00^y \<z<7H0F@SH@$ D\ V V @@ PU ,'$0  S H0 S  0R 000 $Q P h P 6&0 0 0  (0sS@@VH0Sq i:SF [P@ MP 00CS000CS0 0S 0S P  0P-00@ 0S 0S P 0P-00PCy$ PP00CS0` 0S 0S P 0P- 00PN"yK$8 P$d0$,P 0 $j ^MP| 00CS0t 0S 0SP 0 Pz- 0 00P_xP R$ @#  0D HMP ary$ Q$jy$D3 0IOV+D0SR 0  P@ DPPP 0  (0sS3PV2 VLD @R {\PP 0 @PV4D\ ,0PS00 D0?x00P0@0 0# 1D 0$D0SvP@ 㢻ᕱ0 H^0FSUDQVT XM  P6 \P4P 0   (0sS@@[P'P  0P )(dd,Sddhdde$e`,et0e 0,Pz 0 v  D0{xD  0Pf |@T@ 0@wP bxO-鈣LMP4 `nx40p0 SC)R L3@00 < @YPPh V@ # 0Sc  0KP`, 0OS. P#0 @T# 0 < P\P 0@ 1̠ 0P 0YLЍ `w@U  0S H0S 110 080 00]+ኰ , P,0S $0(0 08 ,0S(@T% 0` <`` PP $@ 0L@P 0  ,0S w@AQ8:0(S AQ*100ꐥLPe\eO-M<嬢p<Ÿ dP@d @ @@vW`dPV# HPC0; (0BT1 0S%  P 0 0C0 0 00 `Ѝ1 0]|1 0d PHYE 0 RD 00U0S0  3P 0 0 % (CP@ 0P)S D0H@' 0@P@d0  04@0@0Sءeee4ffLf%.P@0 0nC10p dz0XhA-@pPT` 0s  @  @ @-@0MPPp' FP ` Ѝ\ 1 !0 1\0\ !\m| P `A-0P R@P`V 8 00 p R'0`0P0@# F 0P0"0# 00P P $00 R00c00S 00 0`0S00 0S:PQ 1 R AR  B1S Q@-@ P 0S0S00 000-@- @P P@Ѝ- 0R RR0S 0 S 0S# -0\ 0 0 ^CB 0@RA: ^P0@-P@! 0SP 0P00P`0P0000P00P 0!`!1 BP  K-`|M\Pp pF l P@ |Ѝ0<0l0P@J,P@A\  P@7L00P@- 0T@0S0 0d@P$$@\0L C B Pb( P@00s  x101|P@  (   0 P[\UE P[PXd   W $0 U@h X0(Q !0@#   0 \p( x b "1 (!0@020!00C20 HRX (0X 100(0!x0 10 <05P@zUh U8h E1PUAU1P0U0C0100,0Px x00  P@W PB.P@O P@Hd0S\^P@>P@8 nP@1 0x \ 00C20Bx`2!0|\=`$$ P@$ P@ W@ k@X  0 P00SK-Qp(M@ Q 0S Y00[ E(Ѝ PO TH   P0 `PCQ 0 % p$0p0p0.%B>XP`#0 W0 @PU`0ASA0 0YP[  @  fY 0 " B[  0C-QMPp`D P @1X  jP@1P@+U"P 0   SPBA0`J >\2000Z-X  v :Ѝ .X@ K-0$MP PE0 pS 00J P P0.'B T>p7W5 ( >R!n@00@0@pWX0 pP`XW QYZ 0PpS  $ЍW`PUUU@-@M ЍA-M` PXP @ Ѝp@Tp `WP@ 0@-0P@S0?#?0@ `P  @R01 R0@-@KP0   !0S00 0@-P@P 00@p@-P@`P0 p0?#?00@-@!PP 0S 01 R00Q0@-@P" S 0C!AP0 BA0@P0P 0P00sP 0QA-P`001cQAPNP#5@ P00S p p0S!@b!000C !O-Ġ0p `@0WPPM^Ux0U00 S U 00  0 S  Ѝ`ijsPA-@P P(0 0R)U!P p 00^`CP`  \0202^00D+PPK-0PS M@/0` V 0 p@ 0 ` PX >"`V @ ``@V`  V`0 0 ЍPP0@-@P d0P0S 0S00000@-@0MPPp P ` Ѝ\ 1 !0 1\  rP `C-0QMP0@2 0A>SP00Ѝ0pS``PP@0 S  0P@` 0SV0000S00G-0B>Sp` 30-SbPU #W500@ 0S @?TT P PPUP0S5ntQ0@-P@T aP0P0P0`P00a000@0@-P@ B0T00@0@- @S R P  0 00D-||0  @P ^\0 ^ 00 S^000!hilLDA-0P MSp @T Ѝ`rP@ XP @8{0 TP@)  P@"\hP@ 0?@T @T Gh@TP @-@0`PTp @z0s  @T00 0A-0` pRPF@T: @R 0 RR0p0c0^ ^ .  P g0^ 0E 0^0a"0 0S00 @@Pp@-P@`0 S:p@ipK-JMLDx4$D`@@T < F?P00P@: H7P@3 (1P@-L+P@'( H$P@ (0DP@P T tP@LH mP@ D fP@T _@DP @L H0< 8 40,$#AK-Mt0T(0$(0D$   , 4  夀┐ℰPdp, 0 peP@ Ѝ11`a$ P@. 7P@(   *P@P~$,P@(P@ $gP@  P@fP@ P@P@fP@  P@fP@$ P@ rP@  P@$ P@ ^P@( P@ , P@eP@ dP@ , P@ ( P@  P@  P@, P@y P@r( P@k  P@d  P@]  |P@V  uP@O  nP@H  gP@A P@:  P@3P@- P@' P@ 0(P@,0 P@  P@ ( P@0 @(,$ 0 p O-,RSM`pP @RЍ R000   $P@0S% 0S 0 00  0pP@ pGW0  0S @c@ S-00pGPZt-/001@-@0MPPp P ` Ѝ\ 1 !0# 1\ U P `0 S00 0  RK-0`@Qp0pPS3 Q @ PP  0Q00"0#^  Y Q 1Q0"0#^ PQa0Q0,PK- S07$0 0$0, KQ$@,P P+ \ P;$0" < P1,0  P0X}   ֚vXt   0 `Phl@d0 @jP@\50 0OhhhhhhTiT ii'T(Ti$i4iPiiixiiiiij8jO-鼢MR0p 0 P| |\ddh@lP`0\ @j0  0iXu X  P r1l@9 PP Q: I0  0HXQ X  iP0 Xx _P 0S ЍH!  ^ 4 0  0 00 l000 0 @ 0 P@`  0P  H  P~   PwcIhhjhtj|jjTTTD-\\@ 0P S 10`S0c S࠱ 1S01F@B-PP 0S  0 S 1 S0F0@-00<ЍpG-(MP 48 @`0P T 0  08Ѝ 0pWPNP P00CST p0x  00ST <0H T (08 00 0|Djhjjjk(k` 0EL L0 0RP 4Ѝ04l$lkE-頠(MP `gp   d 0 P P0 0!P @ (Ѝ3l$lkpD-錠4M`@ 0```PP H0X  @0 0< @ (0 4Ѝp3pl$E-P@ L1 P @!@1 0,!0 {! 1 0 0pp pP0`q0 SP 0Zp 0pPq0 S 0Hp pPq0 Sd1 llktD-h MP  `pP@6 UC 0= $1 P 1 P 1 P 5P!U PU 0 P$0 Ѝ0 0Փx0lp0 0LT004@0 0P/$Tl\l,S(xl O-LqMR`$P@ 0U00 @4 2`1Q(U=YE ]E@  VfD- R2 00r$ $$    ` 0Qύq`0aX400 0cS b,0( =9 B =( ,0(0S0,0(0 0S1 01\1 801Q0 < 000@0P X 000S40S qߍ0q$!110  ,fc(  (, -?Bl-PO- Mp @0`0PV2`0a V0=iF mFP @0 0cS b 0=9 B =0 R0S  0R 0 SR  08zЍt+@B0@-@e+Pb+0@D-XM@ PP 90'S00S00S 0/S/0C0S)00ڍjP00 P p   P  PP |P 0 .S. C R .S.0C0.S.0C0S 00*0@-@+P*0@C-CMMA}`(pP P*x0: SQ * P0: SE P 0S  Ѝڍx: S'  S  00 P P S S@* p0 PPP BM@L 0z0 0K-M 0NPp6  GP`14 P @tT  P @t Pt 0S Ѝ P@  A-F*-P-<*0@-@P0;;]P0E-d MP pP@ QH ` 0>T 00CS09pP@ Q, P 0(T 00CS0ڤk 0@T ݍ 000TWWNWW<%A-`jMcpP@ Q& 0Tp P 00CS0 @]Tjߍ倚R 000WWG-QdM`p P)aP h0@'S00S W 0 @TVdЍ bV T 0@  P0იJ"8O-鈢xM@`P  00,pPp p(0: S  0 xЍPz  0 Pp 1 @6U  .  dP+ 0.S @I  U    0PpU  w 0RS p LhU BbW 0 p0S X 0 Rp 0S @0.S.0C0S @!h0@-S@ P S U 030\P0SP0!P 0@-S@ P S U 000S+P0 P p@-x@0P@M`T0KS MP0 @0H  0 cP00Ѝp D-ࠟOM` @pPP V PU  0@ 0~OߍBVP P @ 0ᮑQXt*D-ࠟOM` @pPP V PU 0@ 0@OߍVPP @ 0p 嶘Xt*D-鸠hMp P`P@ W `V pp0@ 0hЍU`T0, 88 ˢt*lE-LMp`  @YP U@0 㧑P.U00! s' *@T W PU E0@ 0豎ЍuUPW  R @4<0 0AP嚎`U l*lmE-=<;:9876543210/!++*,2@P0dS!@TP3TP `PT \#TP0dS T\PP0dS PK-FM4M4,K S 0 Pp/SPY/P `@g`Fmύ 0 cP&4(HW/^ `g\ 0@^ PY mߍڍ``Fmύ 0;aP d0@P 0 㗎 0S 0F͍4   i@ }P @T ,E-騢P;M Q `0PS @/TR @T\lPP @T<2@P00 @:QQ` 0:SS7U  f0U/S   `P 0S 0S@Q4;ލ5.P`3: S0/S; .S5 jOP  0冎 0 S/R  s!m|P @ 0؍0/S`Ҍ @P0qmlhmO-M(clpV   0S  jP@ X 0S $P 00CS0ߍzQ  %00$(R$ $0S2΍ 0 P/eP2: S  PV 1V0 0K0.SH \SC PP. 0.S' \ P(0 0C sP V 4 XP , h  h%C0S e :800CS0zP0.S &W NL0 0巊00CS0UP0 S/Rg , l$00$0^ X\m*hp@-Q`M@Pq 0SH R5 0S4  0: S,  0: S&  0: S  0: S  0: S @ 0: S `Ѝp P0: S P `  0   uP  0 PP P  Pp@-M 0`P jU @ 0 EЍp@-@"P @-"P@-@" @z0@-MMPPEd@P0 T P0 @0Ѝڍ0D-MMx@@Dp`h zPP 0 ЍڍV 2  0ࢉ4#@-CMM@@D0p `d*PU 0ċ Ѝڍ@-@$"0S  @K-CM M PPEQ`@ "P  cPpP "pE YA p8[@  P Ѝڍ00}hP` @@DP J @000CS0 P00wPcpP@5V++/P@-@P`Pp3P(0SGP jk P 0S]UW P0  kp@YPUPPP@-p00`P@ @P0P0 @-p00`P@ @P0P0 0D-@tPP   \0@ sP  40@ 0Dg@0D0@Q- Q0SC0CS@-p`P p@0S D-RP 2R+ K P@ 0 P {`J0@pTh0N a0@TN 00~pPnO-bM` b/ p PApQP@ `V 0  bߍl0 `.P @m@DDPA DA@A`D%@:T``D- NDAK@`D-DD0M  80  2b3c!ЍP@-M0#,<@$K 0`S<ЍD- 0  0 lPQ 0D-,@( XPT0  0D-0@, Xۤ,PB`0 -,,0 $00 PD-TP  @0 \ ,0 ^ 0 HP@-M@ n 0 0Ѝ0D-鐠 *P@ xPP  P P HM0Dm00@| -0 \ 0D-P @ 0Pp/  0p  0p  0Dq 0 Stq0 SHq0 ST"uO-ȡwM4  p BI!P <B 0}AT 0S*T1 @Rv0J@i  00CS0wߍ:Iᙌ ᑌ  b`V @ P *8t h C @uDu@-M #Ä @2ЍE-XX0p `P0?@P `PDV1D-DjM` t4.P Pk l@勵Pp  a0SAP@ 0S@T 0S|@T 0S@T& 5 8P@VP p2 +0S*0PS$ .S 0S᰿0S jߍ P oP  ႃP ᎿwP pP uuuO-888" &M 0$`b"2  0P@P`P] 0$ p(B(0$ pB(0K-M4 | `0 0SPP``@TG`n 0j4`n 0cpW70 pV0 S+00 ! 00 00 [ @ 000@T  @|T P 40 n 0SP Ѝ @0T  e0 0R00 U 0@   @{ =0@00 @  0q K- M, p =`@6 0PS 0|S S eS 0  # 0|S S eS `g0P S ` Ѝ 00`nS 0<0 0K-8M p0 \ 4$GP`X, WQkv0JRWz`^ Q08ЍK h `0(B(rB`$ <0 h `0(B(a0L^$08#80 Rpp ,04 0S0,0N* ``@(T 8Ѝ`n 0 `(0 n0S( 0)p rg 0S^ 0+S *S 0 0$0$ @X M(W00 `A ` 0nX8ЍK,X0@0@(WbW 010  $ RQX #,@  $04X` `4`10(S` ` ( f0S(``@(Ts`n 0(`0 n{0Sc0 01^0  0  .0,  0=`,.0bW0  $Q bW $ \^K` 0n @, 0 |S / 4 S, eS* 0 0 , 0 010  0 00,, 010  0  000`n 0= ? `  0M$  0A \L s 0R 010  @0@. 0 0S 0 = 0S  ` 0n   $0<$  0B C010  0^  0$0 000 0X` (0n 0R 010  @0@|0 0Sd  |(0 @RV(0=0 SL  0 0$ ` ~0 @0` @0S3 0=0S($0,8$ G?S4 {S>  0$,S $  }S  e0 0R 00 P 0 0dS  $ Q$08 0 0a $0 800$ 0 $08$ 00 ( 0 0S0 0 s00S  e0 0R0 0 00$ 0 !f`d0S 0d`@h00p 8C8@F`,0S 0r 0a8ЍK`0Sr0 r 0a8ЍK`^ v`0^ ,$08#H``0(SO(L 0) ( 00 S` 0L5uj`0S-0r  0a`0S0 rk`$ '`0$$08S  j mf0L\@+ $4 8#Re0T 000@00("Qe0T 000@Tb 05$0 8#80`0n06@e0 0T0@0`j0S0r  a 0*? e0 0R0 e0 0R 0A-aQ`^p$pM@P`0 P`0 Pl0`d `P{Ѝ@-l@M` @Ѝ0@- @PdR U00dR0S  e0 0R 0000$0!8#8P UdR C-M `@P U  U   V0 V001 S񏐁 "|7Xxw}` x`0n ЍCG 0` R Ѝ`0n`PpU` `  `0 np$` 0`0pS` 0` pi0SF 0 R`0n p`p`P`U` `  `0n p` 0n` 0 e0 0R00`b0pS`  0`p0SPE`FP `K0pSz`  0`p0SPEp@-@`P 0]SeSd`p@ 0]SeSK-@M```0S Ѝ 0@0S`d0p H0S0S  0Q 00;0Y d0 48#,7 0p48CX pp P `0pS`0p p80S pXPO $ P5 0PU  p (B(Pp0 PU0S 0S0 0CS0 ` -``ЍK` `(B(`$ 0` $0 0`da p  ` 0`0$ ` 0$ 0`da `0{`h `(pB(04A- 0M@C0C`p-S_$0PC$0  0RS P 0P0 0Ѝ 0S 0RS X 0<00 00S 0  0RS$ !IS  e0 0R 00PlU5:e0 0Q00Q 0S pS$0C$ 0} PIU5:e0 0Q00Q0 04P3U5:e0 0Q00Q V0S}  PU5:e0 0Q00jQh i e0 0R0 ^0@-@* 0PpS0 #0P 0pS0 C-PM`3`0/ R0RЍ 1$p0@DH$h 0R$̠@'j`@dT (`0B(p@v`dd0C (`0B(pd`do0Yd0p 1 0$(B( @p@-M@P` t 0Ѝp@ d (`B(0p`5ЍpK-M 0P.ڄP 0 Q$'0 0Sp [0 SD -0Sd  (`B(p 0K[ [- 0TdU p@ @ 0 U P 08#X  K[W 0S 0SF 0 S0;09 0d48#,7 0p $XEH MP ` E(pF @`$ 0`$ 0`d0a @T0KS[ 0[Ѝd 1$0 0Sp E  0d48#, 70$(BH P `  d8Q $("̠ 'P `0@ p $(B(40S0[`` pP 0`` 0S  e0 0R00`` 0Pp`` 0Sl '0Sp@-0@S ^ 0N4QSp S^p@-l0@S p@D`b``_0PS p.6 00Sl`@-x`@\ 0DpPx0 pP` 0 0000  0 0 007Pt0@0t e0 0R 00Q0@-@P Q 0S0@0Q0@-@P 0S 0U0 x0 0x@00@n00@-P@T Q0@S0@-@ A4 P00S @-@0 @0P00@S0@-t PR 0@@@ T 0x0t00&p@-@ P`Q 0 S p@E-̠R8M`@p  2 ^ d`  0PS 8Ѝ @0S P 0S꠨v@-p@ \DP`] 002Q!  e0R 0 0000pP`x0 0p@-PAU`D@0PESD@Up@BP0@- |0PR 0@PPP<PQ 9S0S0@x!$D-8P@  D 0(vD-霢4MP `2 @| 00 pyoe@\  RT 2R (B(0C( R }V4 P(P0S PP4Ѝ   ~ x2 Z< 2 Q 0 0} 0 0 00 00 0}l0 0sP0 0iܥvvvvwww w,w8wDwPwD-L R@ <00C( $  \wdw@-@0S 0000(0n0 0@0@-@0P0n0SS0 4*S 0 S 00a0SS0 4(S0 4?S0ZP 0    QE*0JPN 0 4b0CS74210.-,)&!#"),000000000000000@00000000 0 e0 0R0000@000 0 Q*0 4)S 0000y0 4*Sq0 4*Sl 04=S :S  e0 0Rb 0 0 00S?S e0 0R00  000-0  pD-鬭@  R 0nS0Z P R: 0 0  (0LSP(@PQ:0LS /.e0 0 p 0LdS ?>pD$0FXS ZYG|0$0m Pj*0 4?SeP 0$0! B0RB"@(>=<;:9876543210/.-,+*)'&/ % (0 0$ G0 00L0% Q*0 4)S Q*0 4)SQ0205 e0 0R 0 00 00L0% 0$0 %0 0(S 0<0F$)0% 0$`0 P*0 4?S 0 *% $0 0%00*00 P*0 4?S 0 + 0%00+0.00 P* 0?^ 0 ? 0%00 0`0S0 4[S 0P(0*0 4^S 0 % [0[ %0 r0 4:S 0Ă>\<\0 4:S0 4]S 0 4]S<\< 0>  0 0b R|*0d  R] 0CSX$08#8D0C3SI:GFEDCBA@?>=<;:0876.43210/.-,+*)'&%$#"! 85 0 05 55 4e0R 0040IP 0>00 00$Bp0 0% e0 0R0^0F$% p00  R :F$0% B?0p 0bP {0 0 0  (0P9V0V ,V `  e0 0R 0~0FA$d0\V }V\0( P*0 4?S 0 } 0% 00 `1\Q* 04}S 00 [VI 7\V)  @00  00Rw* 0CS$08#8sS dSj 2 2wSc2 +1pSZ@]V`0[S]   `0 0y-VT0[SQ 0S* 04]SI F$R00S: e0 0R0 004:S .S 0F$0C% 0=I0  0( =SE0 0 0+=C0 0  0.VQ*0 4]S 0 %00 (0X =V:V e0 0R 0 % A0 ̞ZD2rpD-0lP 00D  Pt 0 D000IRVponmlkjih#p0 0 0@4%0$p0 < B0  00 HS e0 0D$p0% 0$@` 0F0 00 HS00f0 ,0T`D$0% b 00 A0% 0$ 0%0p \0 $00 % ;0C0D >00 % ;0C0S  00 % ;0C0W 0 ;0W0 % Z00%0p 00<0Q * p0 B 0% e0 0R00f0 % ;0C0d <1 p0 0 0M0%0p  0<0]0%0p  00%0p  00 % ;0C0s u0%0p  0w 0p %0 0o0 % ;0C0w ]0<0 0 0 ;0w0MԐ@-^P@pQDRN*0  400C6SP543210/.-,EDCBA@?CDEFGH876543210/.-,+*)('&%$#"! #$%&'( R0 0C0R\.. R:\ e0 0R00 0 0C0   0@-!X$0E@:SEKCBA@?3=<;b9876543210/.-,+*)('&%$#"! 8 0(SnS ^S*0 0 0E$p0% 0$P0  Q:$00a0S0 4\S 04)S0$ ,  .00`0S0 4[S 0P(0*0 4^S 0 [% $00[ %0 $0 4:S 0Ă>\<\0 4:S0 4]S 0 4]S<\< 0>  0 00\: e0 0R00| 00T9U+1U(U )U `P $P0>0E4p %0 aE4%0 Pc 0%0 P$ U 0E0@% 00b0 0$I>U <U  P000={U0 P(0  20nS^0, (S0^ )J0@- @ Q: Q*0 4#S  Q0*0 4 SQ 00000ǞP00 p@-P@`Z 8#0\ P p 8#R0 0@-@0 8  0 @ 00SZ@P N.00SAZ v p@-P  `V@ 0`@0S  V0\ p@p5C-p`NPAT V 08C81 T oPUZK-0 M r  P RB@NnXPP18pAU00 8C81!0TTU  P, U+ @HXk p 0L$48 C Ѝe0 0R 00 0S 08C@-0@ RC08C8 1 B40 `B!0248!(0B000 0 0BQ*0! 0`0pV PU 0pP0! 0e0 0R 00PPP  !!k@-1qQP@` 0 0P[ T  lB!0248!@B40 0  @R  01 8C^ *C811 $B40  8C^:8S@C811 4A8SD8!1P! 0 4C0A8SA811@ 4J00@-@50  @R1!00 A-A#/ 00 p`$(BH0  @XR1T  q 0L@@@p@-@1Q 0`~ N8p 8C8R  N8sA 0 1C-@PdUT M\`p !T0dSTЍd (`@B(p0T 0 L0dSds (`0PEB(p@U00T00SK-Md!`PQN΀ 0I!0U00 U0Sp8` 04KHi0 `pI( 0YHᇀp0 W`0 048CT K(!!lI81l1 W Ѝ7 H D81!PU QDH` 0pI(!!AAA0<0 PPpH0 pW0D81 !P0e0 0R 00K- 0 M110R0Pp1*0 8#Ƞ hF p00 AP 0S  @1T L  00@@TA  0P8U#x:Ѝ @1T 0 F(@T08C81  0 8C81 R00 R 0S S 0S0000A3?0 048C811  0Q 048sK-` Mp\ @P*0 R A( 0Q R   $0 0@8T#X*0 R Ѝ(*K-` M\ @p*0 R 8CXp @ 08T#x*0 R Ѝ\(0  ,A-pM4PP@P 0`)0&0'0$0%0*0+0(0 P@````,p> 0`]PU50 0p 0f^ ^ 0 0 p 0Q 0$ 0$ 0SЍ0@-@Q PPPaQQ 00lQ 00  0@w0@-P@U 00 0  000 S 0S 0$00RPDQ(PP,e0 0R 000@-@P@0@-P @Q  QQ Q0@ 00\$0$0 $00$0  S 0$0 0@-(PP @T0 0 000@A-Pp\`@ 0S* \,,0 R0 0 0  F4aQpQ 0 ` @P rQ 00S A-08CV0Sp@-P@`UD! Rʂ1b1 ,D!pGGP (0 0 ( 0Q0 Z0P000p,e0 0R 00pp@-0@PaSpS `3 rS1  R00 R 0S S 0S000 0CR00 0 R 0S S 0S0000 0 B 0@0 0p00S P 0S P08CR@-@ ȠLȠM 0@2Ѝ@- @pPT`  0 @Tp@- @`PT  0@Tp@-@pPT` 0 n@Tp@-@`PT 0 @TpA-@MpT`P  (B(0P@TЍ0@-@  P0000A-0`pS 0S@ T P %0S0S @T00p@-@MQ `P   00Ѝp@+nЍp@p@-0`PS 0R S0 @T ,0 R p   02@T ,0 R 00@-0PS @00T @T0@-@0P % $04C%$0'0& $B'& ) (04C)(0+*04C$+ *0 @4%0$ @4'0& @4)0(@4+0*pD-蠟`Q`V@P   0[VV&VpD`0 ?H 08$ 0.hhw|wwwC-pM R! ,00SP @U 0S 0rS^S`? VP ,00S T  ,00S XY)X ,00S Ѝ,00S0PU 0p^S` VP @0 ȠLJ%$ @$(B( <PK-` MP VW @T<0SQ 0S8 @T p P P W@ )ЍP,00S0 0 0,0 R ,0 R  0P `C-pM R! ,00S P @U 0S 0aS$S`? VP ,00S T  ,00S XY)X ,00S Ѝ,00S 0 PU 0p$S` VP @0 ȠLJ)( @$(B(5 {PK- `MP VW @T<0SQ 0S8@T pIP P W@ YЍP,00S0 0 A 0<,0 R ,0 R l 0$ P ` 0T$R .D1R 81R ,1R(1 R 0 8S0R0 R0R 0R00R 00R ʨ0R ʜ0R00R0 R|0R p0Rl0h0R `0\0r^r$^$$$L$a$p$^^$^L^a^p^ra^a$aLaaapa^r$rLrprrrarA-P pR ,00S `\ S 0 nS@ T ,0 R V  ,00S WXW ,0 R pPp@-P @`U0  0pRp 0Rpp  W 0S bj l0S s 0@-P 0"  03Q  0 @R 0S T Q  Q 0@-PpQ` @0T  0@T@-PpQ` @0T  0@T00S  0 R  0S  RPK-PpU`@ 0 Pp0U@10 X P P ,e0 0R 00p  @ 00$ B4 0$0#8C$0 ( B4 0(0#8C$0 P@0U  0A^@p 0LS/ pS$ ^D4 P00U0@^  0 ^10 0 0 @40@ 0  0BĠ0 00`1Sp-PP0 8C8(BS 0S``\Pp@-0@0O @L@-P @00 $ `p1@$0P pP`0@0 S00 0 0 0 R$0 0AĠ  p@- PAdBD1 @` p0p@-@! 0 `a P0f0e B1U$ 0@P4C$ 00 0 0 p-^0 N4S ^ ^ 0 N4S0 4Q^@-@P`Pp 0Q0R0WP \P e0 0R 00@haG- a`Vؠ 0pM@ % 0  + 博 0PP @῵P 0S@P e0 0R00Ѝ  ȵPVQC-@`P TPJ U0 0S ! d 0o0S+ T`H$HᏑPp08#xᣑX%X08V#HVVT` V e0 0R 00Pp@-0P@#60xQ00S 0R p@  `!p 0x`yTX YO-`M a@` Pʙ XV00U00Sp  P   P66PP @P 0PS@3{ [ F Mr}@eu 0Pp1 6P@0 P DtU5P`@0 P$=U@5P`@0 P$-U@W Ѝ0 e0 0R 00u 0pPp 5P`@0 P$U@4P@0 P tU 0JPp  0> p 0 2 p  0%Pp 3P`@0 P$U@#~0 Pp 3P`@0 P$U@P3P@0 P }UgY 0Ppd 2P`@0 P$}U@2bP@0 P fU@? 0Pp= l2P`@0 P$VU@02P@0 P @>U 0Pp 1P`@0 P$0U@1P@0 P Ul 0sPp P1P`@0 P$ U@1P@0 P U 0MPp 09 af AF 0 e0 0R00  `P\`xSxXPc8aA-H$HB08#x!08#hT Ƞ,X U0 @W 0@ *R@-p`P 0$ 4R` 0@HTpWPK-EMxM^_QP)@pe圵8PE $2R ^ߍۍ 0S1E,x  $ W  R   500` ` 0S^?0C0V0S 00 0I Y0p 0@$ 8 (Rx0x0C$0<$0S/ Y' < P@ PV P ^?0CP$P x0x0CP  0 S 1 !!ὲ<  P ^?0CP $ȻK-0(`M00 P @ pP Ѝ p,0pP P0   0S  0b 0b00 0b00[ P  0@ P T` \ 0; @@p P0S 0S`W` V 0n n0  0 0S0n 0n00 0n00 Q 0 00 A- M(0p @`YP P Ѝ"<00 M 0S   0 ` P0   0S  0b0b000b00K- MP  00 #p 0 0@ PY 0S`O  WR  00@S 0S`T3  D0J0 0FP PW T0D 0 WD ЍT 0S  0S 0 c0c0  00D0` V0[:0D0 0Q1 Q0@-P@T $0B(1(Q 0S0@S00 1@- AP*0 c0c 0 0@-P@`p=\ 0 (\ @.\  0@ b\ |\ 0@|K-M (@<p` 0P % P Ѝ0 "<< 00 \M[D  0@ P@  07\0D  T [ @P@a_0 TR0  0qP 0ЍKg 09 C-QM`Pp (  0<  @\ 0  0S `VЍ  0ЍC.A-@P=\p` (\ .\ A P  0b\ |\AfA K- MpP ЍKy  0< X P Ѝ 0< K 0S_0$ C8\0@CF  0`V 0' V0D T `@0h0T 0$ C8  `A Q 0nP` sq  0*P@ 0$ h C8 ! \ K-p <M 0P P Ѝ 0<  0 Sa0$ C8\0@CG  0%`V  0( V0  T @0h0T 0$ C8    ` Q 0P`    0pP@ 0$ h C8 !  K-@P`  M@upL% 0$ C0@e^ㅰTW Ѝ0gT000cWP0p Y00 ^0S U 0S Y W0  P0pP0U Y00 W0SA-PM@pT4 0$ C8!R@ R0"  <  `\ 0 0S U0$@C8 !L0$ C8!  08P ЍK-M0 Sp ,\0 @`R000T 0T T$("<1'  04 8 C8zP`= 0 a ^*0 <$("<1'0 P48C8 \P? U@ `P:0T 0Q0A 0P P P*Q P@Ѝ^0 (R00 00   4 8C8P 0@ P ^*0 $("<1'0 P48C8 \P U@ `P: P0(  04YK-M80 0^0 ^ 8, P00@p^000U 0U U$$("<1'  048 C8PpM 0@q 0['*0 @$("<1'0` 48C8AT`O 0 P00 V030"Sp`V:T< < R |<0000 U00SPE0U T 0Ѝ8^0 (00  48C8 BP@ 0@\00@3P@ [*0 @$("<1'0` 48C8AT` 0 P00 V030"Sp`V:@P@ 0(  04@4 \R 0 B 0\1R  K-`PUᡒp70S4\' @^>WD0=- 0 p0$ <0@  000 (` 0,4 08p0DP 0 S 0 0D9P@) 41 0 . 10%0  p0<0W$@@ 0S 0S P 0 0"@-<0@S PP P $P@P@_^\ZX\ 1 R, p@-@`\0P! 0P0 PR0 R(0 1 21Q  0  R0  R 00`4000pK-M  p(PQ0`Q !0`V P` 2!2! !@8s 8C[ 8s` V R0Y! ` V"131 0!@8s  8C8S[0(r` VYQK Q0P HP`@V0S2 `FV @V X  K0 A 0`!` Ѝ804 0@V11 `V `PR00V0000S! P"<Π4 0P  1 21 0R04S| 1 21 0R04S=@-"M 0n M2<q 0@0C `PU  0J@0S T ߍڍT 0S 0 0K-Ml 00T 8C8 0 T 0 0 S(!R! 0SC 00T ^9  p`&08T ^CX & 000PQ P X  00R S S*00  @ 40R S S*P4 ЍAX08CX C-PpQ`$P`Bp0 0 $0 1!Q`0  0 11`V@c@T G 8pW *0S S*0 pW: Qp *0S S*0 p W: 0S0 0 080P-0D-lePXM`p C fP* L1 @R#R R( @ ;FWP WgXЍ G 00BR@ 0 40 @R R RlR@ D0 @R KP R @ $}ꮩJD- q # D-dP` @qp)0( @0p`0S0```"   0SD-頠` Pzq0@S 0V 0 Pp\ 0S\0 0\  pP\" D-t@p Nq0S 0S 0S00 RD40S00! D- -q ! O-鬡fMR`p \!0 S:  P 0QqI P@a `P@1SL P0R @000L  &R R R 0 0#fߍ0 S 4L P0@Ù0S @ 00S 0 PPS0 0Q` `  x D-,,@ 0S00, O-0 M@S`p @ ! 0PSk sSl S  020U  Ѝ 0. 02PS@  QPC  0 P!L@P 0S004 RL R hR 0 0P0 Sm3L@L@P 0S 00(<0d4( (Ġ8 S3L@(  RŴ@S  S0 S  3 ,P@ 堌 @3 0@S:P  IPl 0 2RP! L@P0T 00 0L@ 1 R R R 0 000E0 S2L@  P= 02P 0BSa ^]\[ZYXWVUTXWbP  P 0"2P0U-   P  0L@P 2PT 0S0L050600 1R<x!P PP 00 S2L@L@P0T 0S0L0:0;00 1RY>2L@| 0 1P Pq  0 / 0 ԋ[ P   P  B0*~L~x x}O-P@ 0 DM 0`P 0Y24  3 OPt 0Y$ 2 3Y T  0PpL`P 0S #0   p 0L0Q QgQ u0 0  2L0  C(0 `93L0  C80  c003P000YT d 0JPp0L`P 0S' 0 p  L Q QgQ 0 0L0  C0 c03h0 0 0DЍ0 S 1L`L`P 0S 000'@'0'Ġp80L01L`0 S u1L`oL`P 0S0 '0000'@'Ġ0p80L0Qh Qg`T1L``  0PpL`P 0S$00 0>=1L`xO-$ `(M @p [PPf 0 2` 2P KPPV 0 2R`L P0R_ @001L  &R R R M0 00 010 0 L0HPP* 0 2R`L P0R* @000L  &R R R 0 0L 0C  b0"20P c02`0 0(Ѝ0 S0L 0 S0L xO-ĢM `@| ~ z0PpwLPP 0SnP"0   p 0L0Q QgQ X0 0 0 @p2T   Pp  02@TW$LPP 0S 0 p L Q QgQ 0 00Ѝ0 S <0LPLPP 0S 000'@'0'Ġp0L0!0LP0 S 0LPLPP 0Sp0 '0000'@'Ġ0p80L0Q Qg}/LPHxD-lPh pMUP 0  C @<0`@W, XЍDmKlx~,SO-,nMp @*M5bU 0  M<P Pi= 0`S 0S  0 MPAU@=U 0 ; 0S 0S 0 P;c e a 0jP  U  @ 0@嬭P ۈnߍ   0 PJP L0L 00S4~hD~~~(@O-\P BR8Mp`  4208Ѝ"2 0 @@җP 0;P@QTJ XJ X YU t1 0ẘ ;PP) 0SxJ$0 00 0 ; 0`S0 1@0 `< 0S ZTMJU h0  0@;P@Q48Jwl L$tdx00CS0pD-\\0 `P|P@ p<0( @00 02 00CS00D-lM00P @|0   020@SЍ0 < 0D-lM00P @\0   00@SЍ0 0D-lM00P @<0   0:0@SЍ0 m<0D-|M0@ 0PX0  0 00@ST00Ѝ0Ipp@-P@`0S|S0@ 00`NI00CS0p`eJD-P M`pXSSS 0H0@00(㐴00CS0 'P Ѝ(~8tO-QMP` Q 00 p lP@T!0  0 $p0R00ކ:0 0P00 `@ 0  PP. 0Ѝ ` 0```;P  0```0 Q  0"P0˫dd0  00I 00CS0J0LXhx,SK-PM 0`p[@pu000R PpZ(A zPpP(ų0p0CS0CWY [00 P00S1,0S "Hb@S 微UI[ЍFzHN@tHH@$ kH oeH (H[00CS0FFQ00000pD-P\ MP` N0> @T+ $  00CS0 Ѝp  0? 0 30 0 @%0L 0@ @@0\j00XXO-ԡ$MR@`p 0 $Ѝ坪 T@ڐ1 01$0  @Tp. 0 00ST@T PP1"峷P 0S0 0  P T Y0 0 00 0 P 0; PY6  pD-`R MP`  Ѝp8 @ 0 @|P00 HO-䠟 MP p` VV00W@@T0 0 Ѝ\ 0 @@@G$@, 0 @:0|ȀO-逡M p`ʩPҩ@ +ũ 00[@@TP Y400   0 Ѝ  40  0"Y 4  00@T4K00d 0 @@@$@4 0 @0ȀA-p`h@pPU e 0A-`pR@ZPU O 0VD-鸠`  p8@;P=0 P  $PPh00P$AP jh00@-@P 0@0@-0@PS0h00@- @0$0P @0@-0P@SP0PP00000@-0@SP S  嫞  e00e00  ᝞P000喞0p@-P@0 SP` 0,<\  _ {000p0E-Mp @PF`pO0 @0000 ! @z0 剋P 00CS0Ѝ X00q `vP@ 00CS0{ d D-鄠0M p 0P`hvP@ 0q @v00CS0ЍDT Ѝ< D-tt0M p0 p`DvPP @000 "0@000Ѝ pD-M0 帧`@ P0&@T 00C S!; 9@"+210370  R 0 Ѝp60  R  048S   0(4"S0 0 0S 0R  0 嫊60ᰉPU 00C S񏐺 4DV`{ ) P 0 n0 }`5  P0  Y0 h5  P H0 W4r @0`00P ]V@ P0P SP0sS 0 #4>00 4 7P0SS0 3" !P  r R 0 D3 B40  A40 P RR0 ҉2 P0S 0 彉|2 0 . fP0s R:S 0 埉2 r GP0Sv0 光1  PPJO ^0 mH10@ P0 q@0 O0j0hL 00CS0TY U %0 4Z h0q 0PttC8GԀ DdЁ@`Ԃ - 0唡0C S  U&%)3D<BFL0 0L0 0 R T 0P0   04C$ 0@ 04C$ 0 0  0 0큁- 0 D-ؠR MPp@` ' 0G  0 0 ` @@@P p  P0 S Ѝ@ w80PጽQP ԚPL@O-X M p PP`0S Ѝ 0S<P  i @" t0 0 @0 0 0F0=P`P`0S x**P`P` 00b 0  i B Ild@-0M@`p!P Ѝ0S P0S0S 0p@0f0S @-0M@`p!P Ѝ0S P0S0S 0p@0f0S @-0M@`p!P Ѝ0S P0S0S 0p@0fh0S @-0M@`p!P Ѝ0S P0S0S 0p@0f?0S @-0M@`p!P Ѝ0S PZ0S0S 0p@0f0S @-0M@`p/P Ѝ 0B&RS"R%R P.0S0S 0p@0f 0B&RS"R%R #R #RA-0M@p&P Ѝ 0BS0BSPP`0S0S  0@0g 0BS@-0M@`p#P Ѝ00CSP0S0S  0p@0f00CS@-0M@`p#P Ѝ00CSP0S0S  0p@0f\00CS@-0M@`p#P Ѝ0 0CSPu0S0S  0p@0f10 0CS@-0M@`p!P Ѝ0$S PK0S0S 0p@0f0$S p@- M0A!QS@P` Q PЍp!PP00e `@O-P`U{M ,  0R p"@00  00&U-%6J(      0R "00  0 00  000 0 0 P0P00{ߍ  0RT  00 0   0@( 00tP d 0PKP30| @Pᘺ(0 S*0]S T,0S  0004l ?0S 0@0 0 0a b0 0004 0 p0  c0PP0 p00b0  kR z 0R Bk 0"J0 00  0 0 0  \C pX0 pC  g0BPPK " 0 0 0 80   c0!PP2 0p 0 c 00kS 0 2@!T PP0SG `\H0@00 0p0CS02W ,xH?0 B@PJ K\` K J J0,O> 00 0 0R6 "00` P  \0  0 PPP0S PP0S S 0 0 c 00k 0'1PP0S\ X !PPpPPk0ST PcD7؃(Ltppx~Ȅ(K- ,M (0p)`P@b 0@TP 0 S@DtPT0P 0Pm @+T-T 0P 00 0!0C]Sasstu~"|'00,Ѝ 00 =R 00000eS0  000000 &R00eS0 000  0eS0*S00$ 000 0000 000  0eS0<S =S0 0 00 =R00eS0 í0  0eS0=S >S0 0 000qSN @e *oP* `  $@*0  0寕, 0 `CnF*@0`0  0` 00:0  00 k  0_T Pn@T  傕, 0  @Cn*@`0P0P0cp@0eSS 000 00" 00[0nS@0eSS 000 0% 0`eV@ iV0eSS ޕ000 v0& @0eSS ͕000 0# 000 |R00eS0 !0@ e 0P@yQP_0eY[ 00!00 K-M,p( 0S`R h@" D0@ 00 0 0h0C 00 00 0Ѝ9D-鄠@ MpEP0  C?0`P'HD 0J0,; 0 00 Ѝx~*K- Y0p`00Xh@T P0U @Th@"cF0 0 @SP @-@`pT P0U @T<P 0 0 A-@`Tp P0U p@TPT 0S0000S00傶ံ0@-0 M@00 P P P Ѝ0@-@@ 0@@-00 0R 0SPA\ 0 0 A\K-MM  @`RPZ [ Y p+ ` P>0h 0LY 0 c aP PQa @ 0,p@T'"(2(N Yp>0 !28  Y 8Y0 Yi0Y0廑Ѝۍ;PK- M0M S@ b Y0 : 0`PCY  a ll 0S0 R R q @ 0ēP`@T P`P`00 ᳓P` N@ 1%Y"&^("@ 0@Y 0 8Y20 Yi0Y0FЍۍƔP00@-@0PS! p1 Q0C`B0J =P00 0Z0Sc0P000ᖔP-A-p`@WP P0@PPAЍPEu@ PEu`K-`0MpQ@@@PᯔPp d৔P`᠔PP d 嘔P@00吔P0  剔Pw 00傔Pn P0d  d p0P `@@ Pl \ 000|PTd0\0 \Td0\0တ~ ͔P9  ǔP3  倛P- zP' ᵔP!  ᩏP ၜP@P;P   ᓏP 协PP NLJH FDЍK-PpM``P@PpPePw@ Pn00 0Pd 0000ؓPY0e0ϓPNP l 0 R0\U e0 R00eP0`PP0P+ P% ݕP  ښP  P ᬓP訓P   P Pp彏廏 幏 ᷏ᵏ᳏pЍp@- 0@SP$` P0   P020=S0  000Sc0P000pP @-Mp P `@ Ѝ0PS 0 0P@P 0SYUp@- M@Z0\P  ЍpP0S 0`V`` 0L\@@ 0 `$ 8 g$gD% 0@-`P`` 00Lt@T8 00l |4g ! I @-@\P 0 4gO-@R  PPPUM`p S 0 `PЍ0P 0 00P 0 .T0 Z  @ p(04ghE-P`MpP` `a 0`L@T 0U @TЍW  0RP0T00000S W `0 P00CS0 0x 0H`00P0000CS00hp@-PMP q |0 Xp0`@T P0S  @TЍp刏P 0  hp@-XP0L0`@T 00 @TphE-RMP`p+Ą$@4P:0S& % h' \( ) ) U'U `DP 00CS00  0S 00 00Ѝ03Q 03 (U1U, `PP @U0P0CS0U00@X3 PD0`20ES3U  0PkU` 00CS000X@TЍP 0442  0  By2 UPk@0P0CS0U]00@X0 0PP1DJ0U^P  00CS020 -00@X 0Dk@U@ 0&0 P#00  080,8d|g4gؿggggP- 0(\0dG-0弁M0@00 PPK 0P00CS0 Z@00CS0Ѝ0000p00P HP` 000  BR P00CS0000 D0P00  BR 0gG-0M@ P0Ƞ0DP( 0 @`T PP@D0/S T@D 0/SpPP @00Ѝ-0 LP- 0 @-0@  -P000-$ M/00`0ЍO-M 88MP& (u< 808(P` @T  800CS0 Tލ4 0808084 P` 40 `S`0C 40 0084 ,0 800X@PdTd0D0eSe0C0vSv0C0S iTi0D0nSn0C0oSo0C0S LẋP <ᵋP uTu0D0iSi0C0dSd0C0S| gTg0D0iSi0C0dSd0C0Sc ᖋPQ ᑋPB ጋP3 ᇋP# ႋP 40SV0,XT@uP09 <nP09 $gP0 :008, P0P0 b08, P0H008, P0@0 @08, PE,008, P08C8008, P08C8008, P08C800 8,P0 0 08,$ P $ X("8@u08,( P(0Oi,($X,Mh(@-M@  PU`p0& 0 00(0S@ 00CS0 T0Ѝ000fpp@-dP@0`  D @ 0H( p0H4O-M@ pPP R b 0 p 00(PY XR p: 0|0P0$ 00CS0Z 0 [ 0 0 0 p Ѝ000l X0@8 1 p 0@0 P 0SS0 00X 0dP 0S0 000X|8  A-P@pM` 00P t0(P  00CS000 Ѝ0@O-MAT 0q zP`PPpG T`X^ 0 00 00(p@b 0|p 00CS0!W T Z 0 Ѝ00CS000 00 0$00D 0 S/R0A00`V @ 0P PỉP 0p/R `Vꪈ@T 0P 00 gh@-M pP@` 0(0SP 00CS0Ѝ0Jg@-M pP@` 0(0SP 00CS0Ѝ0hE-pMP  VP@' `0 00(0SP 00CS0U ЍZ0p0000hA-M`  PpP 0(0S@T00  00CS0Ѝ00 |(hG-MPpP@9 a 0 0 0(pP 0 |  00CS02u U W 000Ѝ00CS00W 0l X0@80  ((0 0(h8h O-M`pVP@6 Q 0 0 00 (0S`?  00CS00Z" v X 0 Ѝ0 l X0@ 80  ||0 X 00CS000 0|(hXh @-M ` P@Pp. 0 00 00(0S` 00CS0Ѝ0Uxh0 R000`@-Pp`@T 0pSp0 0|  00CS000000`O-xqxaM0  0PU' 00X0@X(P@  0S 00CS0@ 0PUЍ0@0S  0 L 0|  00CS0 0`O-MqP@\ 0a0 0PpP0 PD 00 |0@00 PB 0   0U( 0 0 /SPEe0A 00  R00Ѝ 0 <00CS000@-PPP@P0p R 00CS00000`@-`p X8#HR 0@2TLD@DP2U\EPEQRpBw 0@PpGw\2TLD@DL"P<2R@V}G0pG,"0@P0@P0@P0@P0@P0@P0@P0@P0@P 0@P 0@P 0@P 0@P 0@P0@P0@P` RP@@߅P81WWF W3pG0@P0@P0@P0@P0@P0@P0@P0@P0@P 0@P 0@P 0@P 0@P 0@P0@P0@P`WpGw 0@PpGw 嗅@哅P[@-`@内Px'xl倅8#x|p$H&H@e <0W|GpGW|GpG 0Pc0P @@h-MQ 000S Ѝ-R  #00 01 #^ ^Ÿ0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1"0 ! 3? 0,8 " 7? 04 " <1" N^l^0 ! 3? 0,8 " 7? 04 " <1"N^^ 00 01 #^h- 4< ̃<Č̌ R  #0,<#1:0 #^ A^0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0"0, !*,3?0; 0 ",7?0;0 ",<1;0" N^D^0, !*,3?0; 0 ",7?0;0 ",<1;0"N^^ < 0,<#1:0 #^ , , <  h Q 0 "p@-`P@@TpA-Mp`R+ 00  1 RڀP @  P  p` @  p`'܍ -M P 00ЍO-`@$(,0PS 008S1R P( 00 R 2 0( $0S2$0xTP@dTP@D0JSYT00T0S  X00è?[00ë? T @(|! pPE `P000@PD,@0D400P03L00CT0 fX(  8(,  @(L  D@0SP(  01 080S @0S D0S Pp00l000H00  D 0 04 0焀到$a訩 D! !(!!A-Pp`P 0QS  R R0*S @0S 0 0V6,0A?C0CV`0cp8 xl`\`80HX 02#T 0H0PFHX 80002#T 0H04@D 00 4 0C40H D0N40^0@-@P 0S 0S $0S00000 , P0000S0c00Sq0*000S  0@(@L0P 0S 00S0P 0S =010C0  0C40 ^  0 40 0C40'\ \  0 40 0C40 0 40 0 ^ʈ 0 40p l0 40T 0C40 T \`V ЍdO-M  0$  0R!L<@@PP @1 040XU X>Q} h@ 0 00nP 00 400C400  00  00 0bQA  B 00 400C40XP PF 7 0D]0d^%6 0&0 4>&0C400  00  00 0bQlA  B H&10-(V0 400C40H5 0M0nP&5 0%0P 400C400U  00P  00 0bQPA  B 85 0-E0P 400C40PH$0@ 40T0C400  00  00! 0bQA BHH$0@ 410T0C40 Xv4 0M0nP&3 0#0P 400C400S  00P  00 0bQlA  B \3 0-0C0P 400C40 PH"0@ 40R0C400  00  00! 0bQA BuHd"0@ 41LR0C40vH2 0M0nP&$2 0!0P 400C400Q  00P  00 0bQA  B 1 0-TA0P 400C40 P H!0@ 40P0C400  00  00! 0bQA B  H 0@ 41lP0C40@P  Q 00 0@SЍhdM P 0 40 0C400  00  00! 0bQ A B M0 410C40\0T0  0EI-< f%WJ,!0![0 x>s R*4000  $*4%0$ c`00VXk H0`V 0S0  $*4%0*8&0*<'0$ C`00VXK H0`V R0 0 *4 00  $*4%0$ #`000  VX( H0`V@ 0S0  $*4%0$ ` 0S000 % @@T@!T Q P 0@ Pb0 S e  kl0    d@00d@0@0S @ 000  X @P@ 0S Q @ 0RP702@05UT:0    dU 0S @ 000  X @P@ 0S $Q @ (0RP702@05UT:0    dU 0S$000  VX H0`V08#ZD:I` R 040,0 000 T0(VX^ H0`V*4<*<, 4 <000` 00 0S  H0 00 0S> 0S0:`c0)VX3 H0`V0 0媠`F0 Sp x 000080*`F0:`cVX  H0`V (|8*8#"St8 8#8@0`00@@T T@!0T@!T   ckdd   @00d@0 VX H0` V , ` 媢0 d媢0 0\0*`F7RQh00l7h \0R*XVX H0`Vh0 0$ 0 p0C4q0h媡`F P:h0 SƟ0 0 40p p QhS>l0L00T0T00/>0p l0 PT6F L6000860 h 00`0  h0S*T 02CL` 0  40SXH0`I 8S 4 0V* X> H0`V: 40:`ch  8p0C4q0 k 8S 4 00V *0 X H0`V: 40:`ch0S 0n o0T@ @*`F5 8S 4 00V *0 X H0`V: 40:`cP@ @⪡`F 4 00V *0 X H0`V: 40:`cP@ @⪣`Fh ` 0R_@Dt E 0pPq @Dth d0 0h Rb:0S S>l0L0 0T0T00/>0p` l0M P$3l0P00X0`pX00/>0d l0: P2002 XR0 0 8<`    8<`hT 02CL 0  40SXH0`e @ 4  02C 0 31L  400SXH0`H$40:`c 40:`c 8@00-  0)@p1$0H000H0 S V*X( H0`V:H0 # B @ @ :`c00X 02CP 0  40SXH0`2@ 4  02C 0 31P  400SXH0`ȡ(<\Ԣ @X$40:`c 40:`c@ @00 8D00H000H0 S V*X H0`V:H0 # B D D :`c,0 00aD R0q000S @cD0SD0 c@@ @d00T@c(0000d4  @0T@0T@!0d0@00d@000@T@0Sc Rn @00 B 0X0S= VX_ H0`V 0 c 000000R 0S 0b 4 0c A00S*4<*<, 4 <SZ 20 `000S 0S VX H0`V0Z 3000`00  d0 08<`(0S0S 0 R kP 00I0c0  c 0000000000SR 0S b 0 08<`!  b0<0 R@   0 S003,00000 R0S 0S0 0 (Ѝ@-@P 0S $0S04Q($($00@-@p`P 0S P0S 0 S 0 S  h e0P P 00( V4bg(0,04(0f g,`0 0P 0S 0 000-\P*0\SS 0Sl\P:@-MpP 0SB`0S<0S:0S 00< 80180 a< R 0 800B80#480<00C<0S0h0h  h00`0000000h0S@P@P 00ЍP 0S 0 S<0S A-P@QP 0S 0S $0S`(! pP 40S  $( P($| fS>L R :%<,0R0f0L0P00f0P0l00f0l0X $0 #4f4p0%O-dM @0d0 C C^`V*0 0 4d  A 0Q 40 0AC40`V:000d0 S0S4Z Q !Z  000㈀0 Cd0 S0S4\ Q 1d 0 S0S$reJ^Q0Z0 P0SY0&0'0d@0P? P4 PP$0>0@C4=0@^`V*0  04 d @A@ Q0$0@0AC400`F40`V: P P  30# 30P` p@  40  [SR!0i0,0 0$R<0 04S  0 0$ 0`㟀(0iĠ 5  a0R0N  Q0APPP`d0 A 0Q 40C 0AC$ 8  ^F 0 0 40 0^ 0S Y q@i  0 S *d0 S0S$bQ@ R: [QR!B 0000A0!000aC C50g0i<#U Y 0 S 0p <590N Q0APPPU010  dЍ螡ܡ\O-,MpP0`C000C(0 0@C0ca$JJ( ,  00048<LP T030C0X0# B P000!4>l!8  !( P0502<0C0 >lP00 0!4>lv !80 P*0 P0502<0C0>l$a [0cJ l0\K0S  l \/* l00\'0 S*  0l0 c\* l00\K\* l00\0c  0l\* l00\lR000000 BR000000 BRR 00R00@<0C0!8x0!@<0C0!8M 0 ( V T1;:!`b@000C000 0(V0f002 : 0P0000( 0b0c0 T 0d0<20j K@LN/KPP ~D!0KHAK@ K0  gn0@ 1 P eh0[T ST01 <`pP aX1S h0[X SXpP oa_z ؤ00ܩ00ܩ 0-0kܩ 0-0kܩ0@-0@k@_ܩ9s-+n - B-LHŸPMDp @Ÿ XKh Kl d  0 ` _ 00 00 Q0 0 0 M! 0 PH P 0 00 {K"_B00 rP 000 ڌ0@  0/SQ A0/S 0 P R0\K 00 00 xN0\K0 M0\K0 M00 (N00 #NX0S  S 00 W_00 l_0\K0 }M00 xM_ l - B-LHŸPMDp @Ÿ XKh Kl d  0 ` &_ 00 00 C 0 000 vF 0000 D 00 D 0K 00  %RBX0| S  S00 C00 R000 R 0 0 R_ d - B-41L0\K0 p00 00\K0 > 00 0 0 P4X 0\K0 >00 {P_ - B-3LdM#t0 2 XKl Kp h0  d BP 0#RB 0  10 00 0   R00 D 0S*ڔ   k0 f0 G  0 #Q K}OB`KK 0 `KPA 0S-0S 0S` K0   P 0`K0 K` K0   P` K0   P `K K00 0SX0`K0 00 K00 O_! E-` Z A0sSPp  Z0 UP&D0 \ - B-07LM0 $7$ǟ 0 KX0K0  ! @PO\K&I@ BL 0 00 A 0!`KS000AS 0 !S A 0 S0b 0  DA1`  00 P뉽0A000d lK0 J0lK0 pKl*Ap0 0  p O!R1lK  0I@A ! 0 00 A R- 0Q)  0 K0 0KK0001` K0 0KA\ K 0K|0K@A A|KU ` 9P1SA 0P0 pK0 @0K0 @QAT= !  Q81 S 0 K0 KpK00 H`0 K0 0K|0K@\ K @ Tg0 000 0 ^P?00CS05 1A0S 1 Q !0 RK`K0 B00 SN0p0 ON0lK0 4Jd00CS0 0`0 AN0\K0 aM01 KMB 00 Ƽ ¼00CS0 00 $N0p0 N0lK0 Jd00CS0 0`0 N0\K0 2M@A 00 囼@ 嘼!0K ` K0 IE0pKK0 A00 M1pKK 0D0KK0 A00 M@00 M00 M0p0 M0lK0 Id00CS0 0`0 M0\K0 L00 M00 RX0S S S S S S S S S 00CS000 2_) 0@-@PPQ 2P0@-@o@-M@ PЍ@-0@SR Z @@-@M0P 0 PЍ@-@M0P 0 Ѝt@-@M0P 0 Ѝѿ0@-P00MP  Ѝ0图@- M@\ ЍBP @-@M0P 0 Ѝ_a0@-P0@ PP  0TؤA-MpP0 }P,0S)P[0@0  ` a ,000 !Q 0@ Q0T BЍh$P0@-P4 @ 0S A0 0@x( - B-LDM X K` d Kl h 0  \ uL0  0 0 ;0 00 00 P 0WKKBX0| 00 :00 qL. _- - B-LDM X K` d Kl h 0  \ 5L0  0 0 :0 00 00 P 0VKKBX0| 00 J:00 1L/ _- -?:-;:0@-0@PB)?0@-@7b@ - B-LTMp XKh Kl d 0  ` K0 \K0 \0 0 0  Q1 (2 2 l1 0R R \0 0 K\00 KK*KB@0\ @ 0 MP Ä Řp@T00O H X0\0  K00 K_X2 Ld| - B- 5LM%0 5 XK K 0 ^K`K0 00 0k`K0K0 R! 0 SQ  0 0C 0  0S}SM P 0S K JB0hK0 ?=0hK 000 h K R K0K (B(040 0  0 Q0S K 00hK0 =0hK 0 ` h J R K0Kx 0|(B(4Ѽ K 0hK< h 0 00 Q< 0S80hK0 Z? 0VS   6J  # R 0Kp K0l0 tp(B( 04r   K0{0h0 sJ: 0 0 θ0d 00  d00CS000  001 d00CS000 ^J00 ոX0S  S S 0h0 3J_7 8 - B-L@HM hKZ: h  0 S@A cPpK Chp@K @   0S'0dK 0%`K0K  R! 2P J1h K0 K` S  R ! R! Z@000 A0pK0 C~00 0 vHT  0pK0 C0h0 GA@ 1 00 y `@K0dK  0 KP   0S0dK 00 00K`K00KQ0 1 0# 0 .HR00pK =Cp0K K0 1P 0# 00 0 H0pK0 gCnQ000  0 O"\00CS000 G00 0pK0 GC0h0 ZGX0@S@ S S S S S 0pK0 .C_ C 8@ - B-X<LyMP,x1 L< XKp Kt! l1 h #G 0! <,P  0S 0 1 deK \K0\1 0 \K1 45!R00\00S P񟗃D G TH |H ,I I J tK PL M 4M Q  01  M K^FB!01 ! !  R+01 ! 0-S!* 0@  |: PE E E E   ! 01  1 01 0 1 R 6 ! >K1 1 KR,P  !0SR 1S  0S 1  0! 00fK 孵!gK001 奵 VK'!>K  VK( K,P VKw(  t  VK! '1VK 5RP 01 ' VK ' 4 } VK '!! (!R 01 FE1 02 /  h   0S 01 0 $l!0 * EP   W/    ! 0S01 /D0 taEP 0 ! 1.KNP   1  6! %`P01 K0K1 0   K ~"f0K1 x 0 ! 崴1i/KNP  1 5! $_PKG1K01 %00YK1 8   d0 Q!0S YK! 9D 5 202 1d0 2 01 E  ) 0S01 0  1 MjK \K!\01 $ 0\K1 3$\ $"01 .oH 0S01  ,01 m!0YK1 8d!01 ! >K0T 1 P( (2S1  .( 4" 00 #10CR0S(4 0! 0*(404 #10CP0S !0d 1 8" D82 ! 0, d1 D,n    4Q!!0S-P   ! v 1 l  100VK1 &01 \D0K1 F0\K1 h2X1S S S S S S 0d1 %D_O 8X  0HhȦԦ0T - B-|?LCMt/0 p? XK K 0 C 0 8?8/P   U0S񟗀Q Q hU ] HV X Z \\ ]  0S 0 0 #K \K0\0 X \K 10\0P00S X ! K2CB \KK\0P P 0 R 0 0 0 \K0 1  0SA\0 0 0` 00   `ʲP  0S`00CS000 z0\K0 1 0S 0  0 00 0dKb*dQC dK  7 \dK7P \ hK  H*h7C0d0 3C 4 d )C0\K0 S100\K0 1t 00 fK \K0\0  \K 610SH \KK 00 \, \K "10S& \K \  0` 00  T`  00CS0 \K 00j ^ 0hK    0S0 00 `0S h0 B h D00 h  0 坴 0h 0 B0* hK0 00 z 0 αx+BP 0PQ   8 0  h0 gB   xK > 0! \ 0hK0 7 1 01 xK 2P A 0S hK KxK@=P 1S hpK @ 00 % 0xK 0 ! >0h0 B1  v0 xK0 =0h0 B I0xK0 =0h0 A1 0S0Ӥ0 H40hK 0  0dK 0  0  0d K|KhK; 0hK|K0 5 0|0 AxKr=  0S 0hK 0 l6  1 0 xKP$ <  0S  h00  0 0  KhK0KxK;(  , (~ ,x ,r ,  0xK0 0 d= 0d0 wA0h0 sA0! 0xK0 V= 0d0 iA0h0 eA$ 00CS00 N0|K  F 0S$4! 80$0 B00 < 0|KhK=1K40h K<0 41 B00 0Kh 00 L@ KT I 00 ϭ 0 0 ;|0   q0\0 >f0\K 0 \  0 T0  @0 00 <+*X!0R1 00 >0\0 >_Pe   - B-4LlM$t0 4XK Kp h0 l d t> 0l$00 `4TP X0  00  0S Ť ژ 0 0C 0  0Sʤ `K0\ 00  ? 0Sqʜ RR 0Q00 RD00 :0 000 <0 09,P 00 0 `0 >\00CS0ڼ K=B00 墬 t0 `0 >\00CS0ڸ  00 卬00 0 e 0`0 0 =\00CS0ڰ 00 j 0 K 00 P 0 r=P" R 00CS0  0 `0 =\00CS0ڴ00 900 4` 0 @ V0 0 刬 9 & 00 <*P " bX0 S  0`0 p=\00CS000 =00 _Vj 8D+ - B-4LM$0 4XK K 0  @= 0K 0 60|K K00 00 8= RʴQ 0|K0 ^  K<B00  |K0 |K0 J00  B0  00  UP 0-S 0 Sl n n n n n n l l Xm Xm n 0  |K0 Rʭ 0  00S0 Q` \ 0|K0  K0  |K]00 0   R Ka1 hK[1  R 00dKR100 <  0S  |Kt 0 0C 0 0 0 0 |K0  S 00TP p0|K00 00 00 f<00 { - B-LMŸ ŸXK K 0 c900 1E2 0 - 0$0 -0(00 00 $8@00,0@00 " 0 S? ,0$ K0  0K@K0K@ 0K tKK0bBK0K@ @K00Kx0 d@40 `(B(|@ Q @[ `0 0\0[S dPK8Ba:  0S T: 0cS00KX0S  S S S \0[ S dP ! 0(00 7@0$0 800 )00 D00 8':| _ - B-1L8M!p0 1l X KKd0 h ` 8 h1\K0 *0\K$00 ],0\0 80 400Q 0@@A 00 (7 0$0 8 00 00 bDK7BX0 S  S S S00 ND00 80\0 e80(00 70$00 [80 00 _~  - B-1L8M!p0 1l X KKd0 h ` 58 p1\K0 M*0\K$00 +0\0 .80 400Q 0@@ 00 (D7 0$0 8 00 o00 C8K7BX0 S  S S S00 C00 80\0 70(00 70$00 70 00 >_T 0O-qP0U 0*0 00 $00 OK5BX0|S  S 00 h$00 O6 00 _$000 ,6_h  - B-D1L 0(0 00 $00 Kl5BX0| S  S000 $00 50 00 $ 00 5_Ј  - B-D1LX  - B-3LFM#0 3XKH AK 0  /H1 0 1 L! P PAE/K\K@TA ? 1 A @0@ A H0 1 TX \A D0A` S  \ ̢ 0L1 州`KG0\K`K1 0`K1 \!`1R>\A`X 0?0Sd1 5T!D0BS񟗮p  ܤ   (         HAd.K0 xK 1 PAl0Kp@  lK9\KP ddA\ ` \!`1R@dA 0d1 H0p \K1 :pD AK.DBHAd.K0, K01 PA0K@  K@7C!JHAdJ/K0$ K(1 PA0K@  K6Hd=K < K@! 0K@P! A @51`_H ؤHAdN?K 4 K8! 0K@P! A 5E?K R0SyxRvsHA0LC/K1 Ph 2 0\K1 h~H1LF/K01 Ph " 0\K1 hADA nH0E/KL1 3Ph  0\K1 h!D! ]H0d 1 0\K1 D OX0l1 1S0\K1 ~0l1 e.0`K1 v - B-4LM$0 4XK K 0  +. 0|K0 0 RSʼQ 0|K0 V  K-B0K0 , 0|K K0 $/00 0KK0K! 00 K0|00 00K -0 K  0 0 _0 K0 00 -|K  B 0  0 0  P 0-S 0 S갩 L L 0  |K0 Ry  0  J00S0 Q` \ 0|K0 00 l K 0  |K 00 0   R K$" hK"  R 00dK"00 c- 0S   |K70 0C 0 0  0 0 |K0 v   00P p0|K0  c  00 *- [ 00 #-0|K0 R00 4--X0S S S S S 0K0 4_P$ l<8p@- PMR@0ʼ0Ѝp ` 0S 0P P0 B 00@-0@S 0  廞@C 0s P ;.G-PhM@0 0`pSqShSZP hЍ  V00T00!SA ᅞ0̠ P0 . eP P00V00@T00ST00æ?PiP00 P0  -  B ?T00S 0BP`D 060p 0 /0@ - B-2LLM"t0 2 XKl Kp h0 d , 0  0  B h2h" p  V L"110 P 0SOPM \K 0\K0 40\K0 "0\K 0\ K`K0 I0`K0 0`K0 0\K0 `Kt0` K \K0 00\K0 0\K0 0`K0 0 $ K5+B00# 0 0 00 0`K0 0\K0 00 +X0 S S S S 0\K0 00 `K_`0 8l4 - B-x1LLMp!t0 l1p X KKl h0 d ]+0$0 ,0  \K00 K;%0\ K00 000 0 \ K0 K+0 `K  L`0 0 T0 `K0 dK*B0\0 -+ [00 ?++X0 S S 0`K0 E_n - B-x1LLMp!t0 l1p X KKl h0 d *0$0 ,0  \K00 K0\ K00 0j00 0 \ K0 *0 `K  `0 0 M0 `K0 KK*B0\0 * [00 **X0 S S 0`K0 _x - B-x1LLMp!t0 l1p X KKl h0 d *0$0 ,0  \K00 K0\ K00 000 0 \ K0 *0 `K  `0 0 0 `K0 K)B0\0 a* [00 s*P*X0 S S 0`K0 y_( - B-1LPM!x0 1t X KKl0 p h +*0 0 \K0 0$0 + 00  0\ K`K0K! 00 ` K0 00 `00K * 0dK 0 d0 0 x dK )0\0 )Kr)B0`0 )0[0\0 )00 ))X0 S S S 0dK0 _ - B-1LPM!x0 1t X KKl0 p h )0 0 \K0 A0$0 5+ 00  0\ K`K0Kz" 00 ` K0 00 `00K ) 0dK 0 d0 0  dK 0\0 ~)K(B0`0 u)0[0\0 n)00 )`)X0 S S S 0dK0 _ - B-x1LLMp!t0 l1p X KKl h0 d 9)0$0 *0  \K00 K\0\ K00 000 0 \ K0 ')0 `K  (`0 0 00 `K0 @K(B0\0 ) [00 )(X0 S S 0`K0 !_ - B-@2L`M8"x0 42t X KKp l0 h (0\K0   0 0 0 K   R0 0 J 0VS 0 0 ' 0 0 \(K3(B $ 3*00 0 0K `K0T" 00 ` K0 00 `00K ( 0dK 0 d0 0  dK  00 0`0 w(0[0\0 p(00 (b(X0 S S S 0dK0 _  - B-2L`M"x0 2 XKp Kt l0 h :(  000 Q   0VS 0T 0  K'B \K 8 0R0S  000 \K 0 R0S 00S0  0\0 '0$0 z) 0 0 K\ K0`Kd 00 ` K0` 00 `00K ' dKd0 0 C0 dK0   \ '0`0 '0[0\0 '00 ''X0S S S 0dK0 _  - B-1LTM!x0 1 XKp Kt l0 h ~' 0  \K0 0S Ә <0$0 (0 00 K\ K0`K@! 00 ` K0 00 `00K \' dK]d0 0 e0 dK0 u0\0 C'K&B 0  0`0 3'0[0\0 ,'00 A''X0S S S 0dK0 E_ - B-2LhM"|0 2 XKt Kx p0 l & 0  \K0 0 0 0 P `K 0R0S  000 W`K 0 R0S 00S0  0`0 &0\0 & K;&B0$0 ;(0  000 K\ K`0KdK 00 d K0 00 d00K & hKh0 0 0 hK0 0`0 &  \ {&0d0 v&0[ 0`0 o&0\0 k&00 &]&X0S S S S 0hK0 _ - B-1LPM!x0 1t X KKl0 p h 4&0 0 \K0 0$0 ' 00  0\ K`K0KV 00 ` K0 00 `00K & 0dK 0 d0 0 " dK 20\0 &K{%B0`0 %0[0\0 %00 &%X0 S S S 0dK0 _ - B-2LdM"|0 2 XKt Kx p0 l % 0  \K0 J0`K0  0R0S  000 #`KR 0 R0S 00S0  0`0 %0\0 % K%B0$0 '0  000 K` K\0KdK2 00 d K0 00 d00K f% hKgh0 0 o0 hK0 0`0 M%  \ G%0d0 B%0[ 0`0 ;%0\0 7%00 L%)%X0S S S S 0hK0 N_ - B-1LPM!x0 1t X KKl0 p h %0 0 \K0 0$0 & 00  0\ K`K0KA 00 ` K0j 00 `00K $ 0dK 0 d0 0 M dK 0\0 $KG$B0`0 $0[0\0 $00 $$X0 S S S 0dK0 _ - B-1LPM!x0 1t X KKl0 p h $0 0 \K0 0$0 & 00  0\ K`K0K 00 ` K0 00 `00K l$ 0dK 0 md0 0 u dK 0\0 S$K#B0`0 J$0[0\0 C$00 X$5$X0 S S S 0dK0 \_ - B-1LPM!t0 1p X KKh0 l d $ 0S0Ӕ0 70$0 % 0 0 0\K0K 00 \ K0z 00 \00K # 0`K 0 `0 0 ]0 `K0 K[#B 0  0\0 #0[00 ##X0 S S 0`K0 _p - B-1LPM!x0 1t X KKl0 p h #0 0 \K0 (0$0 % 00  0\ K`K0K 00 ` K0 00 `00K ~# 0dK 0 d0 0  dK 0\0 e#K"B0`0 \#0[0\0 U#00 j#G#X0 S S S 0dK0 n_L - B-1LPM!x0 1t X KKl0 p h #0 0 \K0 0$0 $ 00  0\ K`K0KV 00 ` K0 00 `00K # 0dK 0 d0 0 m dK 0\0 "Kg"B0`0 "0[0\0 "00 ""X0 S S S 0dK0 _(0 - B-2LTM"x0 2t X KKp l0 h "0\K0  0 R  0 00 \KI 0  R 0$0 $0 \ K00 `K00K 00 ` K0 00 `00K w" 0dK 0 xd0 0  dK 0\0 ^"K!B0`0 U"0[0\0 N"00 c"@"X0 S S S 0dK0 g_4h - B-x2LhMp"t0 l2 XKl Kp h0 d " 0  00 0  R0SҠ Tʔ 0S0  0SӤ Bʔ  R  Kw!B0$0 w#0 00 K 0\K 00 \ K0[00 \00K !0 `K`0 0 > `K   0  e 0  0\0 ! [00 !!X0S S 0`K0 _@ - B-x1LLMp!t0 l1p X KKl h0 d s!0$0 "0  \K00 K;0\ K00 000 0 \ K0 a!0 `K  b`0 0 j0 `K0 zK B0\0 C! [00 U!2!X0 S S 0`K0 [_J - B-1L`M!t0 1 XKl Kp h0 d !  0  0S0  K B  0 00 x P  $ u"0 0 K 0\KT 00 \ K0\ 00 \00K  `K`0 0 ?0 `K0 0\0 0[00  X0 S S 0`K0 _T @- pM 0@p 0` ? 0090P`0P``  0 `P`f ` Z Ѝ - B-1LPM!x0 1t X KKl0 p h K 0 0 \K0 0$0 ! 00  0\ K`K0K8 00 ` K0 00 `00K 0 0dK 0 1d0 0 9 dK I0\0  KB0`0  0[0\0  00  X0 S S S 0dK0 _^ - B-x1LLMp!t0 l1p X KKl h0 d 0$0 ]!0  \K00 Ka0\ K00 0E00 0 \ K0 0 `K  `0 0 (0 `K0 K&B0\0  [00 X0 S S 0`K0 _j$ 0 0 0 0 - B-0L4M l0 0h X KK`0 d \ ` 0t S0  00 ? 00 +KBX| 00 +00 f_t$  - B-0L4M l0 0h X KK`0 d \ - 0t S0  00 00 *KBX| 00 *00 3_z  - B-0L4M l0 0h X KK`0 d \  0| S0  00 00 *KoBX| 00 *00 _ 0@-0@= P - B-0L8M l0 0h X KKd `0  \ 00 * h000 00$0 K-BX| 00 *00 _ ԭ - B-0L8M l0 0h X KKd `0  \ 00 P* h000 00$0 KBX| 00 T*00 _ ԭ - B-0L4M l0 0h X KK`0 d \ O0 00 00 $P+00 )*KBX|00 00 *00 R_t ԭ - B-0L4M l0 0h X KK`0 d \ 0 00 00 x $P00 )KBX|00 00 )00 _L ԭ - B-0L4M l0 0h X KK`0 d \ 0 00 00 B $P00 )KUBX|00 00 )00 _, ԭ PA-@ P`  PP > p PWp@- 0M@S 0SЍp0`PP 6 0`jp0 ` c0  0` 00 00p@-RP@`P $VpڬP$ p ' " 0S 0pĭȭp@-P`  @0S  p 0`pp@-@P  `s0S  0P p0@-@ PPU00 0 - B-0L4Ml0 0 `0 KX0Kh d0 \ 00 h 00 k KfBX|00 00 ^ 00 _  - B-0L4Ml0 0 `0 KX0Kh d0 \ 00 < 00 ? K:BX|00 00 2 00 _ -) -& 0#1 0S 0@-0 #1@CRQ 0 S R00 0 T0A- 0pS0`V 0#X0A0DPU 0S 0#X@00X@A- 0pS0`V 0#X0A0DPU 0S 0#X@00/@  00 0       00 0 A-@ Pp0#aU0P0@P@U - B-0L @T - B-0L0`K0 >`K    0 \Rј  Q0 00 VP 0 @0 0`K0 BKB0 0  0 0 0c X0`K0 00 !00 M ;_@-0@5J=@-0@ 0YJ&J.0@-P  @0IJJ0p@-00M` 0PIЍpp@-0M`0 PIЍp@-0 @0J@-0@  J@-@  0!K@-0@V$@@-0@%5@-0@(*@-0@*@-@  z,@-@  1@-@  1 - B-x1LHMp!|0 l1x X KKp0 t  l Q0\KI0CFW!000 0g 0 ^0SgE' g 0CFNT  0:#: c00 @T}@-0@@0Z%ZU  Nv `c}ό ^f0M0 0fQ0@-0M@#1P` 0 p@ 00 040 @ 0 `0S ЍA-M,P`@  @ @U p 0S @  0@Ѝp@-PMU@0 `    0@Ѝp-0S @. Q0  ô0Q<00\00S\LQ< 0\  0@-RMP@p`rT 0 PpH M @o ЍRџ000p@-0P`#1A 0T0@D*"*0S>000pp@-0`P#1AA  0T0@D*"*0S>000pp@-0`P#1@  0T0@D*"*0S>000p0@-0P@#1 0T0@D*"*0@-@p$`0 PU0 = 0# W$ 1 QG-p,@L040+0  P`00  P` - B-LMß | ßXK K  0 x K,00 4    00 @ 00 S0 `0 \0Kd0 : 0 0 S@A@  P  0 @ 0$ 0t K0  t Ko PT 0 R @@ T: 0 0 S@A@ K PB  0 @ 0$ 0t K0  t K/ P 0 R \0[S dP@@ KB\0[S dP tK  %7 tK  ' YX\0[S 00 HdP CB_R-0 @-@@-@8p@-@`P0 U0!RPp@-PM`PA $m0 0 @P A000000 0R-hEPFFF8E<0 R0 R  $0q^Q(  gWP  0S 0 ቪЍ mvP  0e0 k0p  0^ 0 t0pnP ge0p W0 1SS T .E-` MP0AS"G`HIItG<0 R0 R  $0A^Q  T P Ѝ ЍEP  00 p @0p 0 T@ 00 00 ȶW Q!@0@P 0 T@ 00b 0 dⰶ0@ T0 1SS p ᕶWpG  0}*uQE-pA X`0 S P@ 0 0  0  . P$P0$`SX  bB!1b317c!Zx X0x0cC1!c#!'b!l0Qx  R0`RE-ph 8R- O@` Q 0 @d0P A  0V0:U*0U0:0U0:V*0V0: z 0 R o0  0   f 0   0 ]0  0   T 0  0 K 0 B0 0   90 0 P  A-RqP`@  0dT A - B-x3LhMpßl0 l3  KXKh `0 d \  0\00 3 0x X nP00 剰Ĵ \  | R GYP 0§0 x0 b   q  A0q$ 00 0 X BQ X 0 00 X0 00 0$ 0 $0 0 0X!0 01 AX R 0110  X0S $ B0 S P U0X@P0 X0 vKdBX| \0 S00 D00 P 1_HP$ - B-x3LhMpßl0 l3  KXKh `0 d \  0\00 3 0x X P00 墯ݳ \  啯 R `rP 0§0 x0 {   q  A0q$ 00 0 X [Q X 0 00 X0 00 0$ 0 $0 0 0X!0 01  ZX R 0110  X0S $ B0 S P n0X@i0 X0 K}BX| \0 S00 ]00 P J_NT$@-\0, @S  0SC6$@-\0, @S  0S2%$@-\04 @S  0S!@$ - B-LŸtM Ÿ  XKK K| x 00 l `0 \0K d0 0   RK0  0  0$0 (B(t0K8tK 0 00  t KP000   p0R0S`\0[ S dP  KB\0[S dP00 X\0[S 00 BdP _TW@-@p`P0 U0 PPE- 0M`0CPS$XYpZ YXx0P0$  0qW# GP0xЍ@ 0 0᧲T0 @T@ P0 Q0 p@0 T@0 R00 0v@0 pP P!@0@p0 T@  R00c 0ZR 01 - B-LPMDŸD0` XKd 4Ÿ K l h  0 \ G00 B1 0 徱 R 0S 00 $ (00    R$   0P 0S P(00(0000  ݱ0S  0 00 \  P0⺱KbBX0|S 00 600 00 N\Z_Ĵ - B-LPMDŸD0` XKd 4Ÿ K l h  0 \ 00 妫1 0 " R 0S 00 $ (00    R$ e  0tP 0S kP(00(0000  A0S  0 00 \  /AP0KƿBX0|S 00 嚫00 R 00 Ⲱh_b_Ĵ - B-0L4M l0 0h X KK`0 d \ 0 d00 唰00 oK⍿BX|00 00 d00 _jL`Ĵ - B-0L4M l0 0h X KK`0 d \ 0 d00 d00 ?K]BX|00 00 400 _p aĴ - B-0L4M l0 0h X KK`0 d \ 峿0 l00 400 娿K+BX|00 00 00 庿_vaĴ@-$0@S 0# 0(0c- 0 #Q00  - 0 #Q00 $@-@0($0 S(`@4@-P@`pGP 0 @8E-p` P@ 0<0Z $0 SE M- B-LHM00@K`0 X0Kd0 0h l0 K\ 0X0  @K KⅾBX|0^0 00 pd|_ - B-0L - B-4LM0 4ğ x0 X0KK |0 t  0 00 Q2  ,  0 0 00 Q0 80 000  0  0#Q; \K1  0MQB 0 偲 \Aሸ  P Q0  !00 0㇥  咥00 ^0\K0 0  0#Q 0pKR"0K $ $0 00 0 00 QH   0 0 0 0 00 Q 80 00 r ]0S $0S   pK  00 (0S 0pK0 KB0S  \K >0 00  0  0V0\K0 00 X0S 0pK0 `_<D<$P0 "-  -VP$0  - B-2LdM|0 2Ÿ p0 X0KK x  t0 l 匳 R{ 00 0SO P Jڠ dK 0lhK0 _0`KhKd K0 ڡ0hK0 墡04hK0 P0\K`Kh K0 ˡ0hK0 員0`K0 叡0dK0 勡\0 0 0 ڴ0K 0 0K0 K0 < \K0 0 0 k00 P ڜ 0P00 h R 0 00 00  K⓲B0hK0 >0dK0 :00 !0hK0 200 `KX0 S S S S S 0[00 \K_Ld$@-`p0W$P0 p @ 0@-@P0 UP0 0 0 - B-LßM ß XK K1  ! 啲01 `0 \0Kd0 |0 x0K0  0 !R ? !0  K  0 K0  !  !   ! 1((0 F   ?101   0  $ 0 ( $ K0(, ,K00 , K0ݡ00 0!K0֡$!0 K ( K0 0[S P0[S P ][x0[S P \0[S dPKiBIGX0S S 0[4 S P!40[8 S P8x0[< S P \0[<S@ 0@0 رdP _\ - B-0L\M0 0 |0 KX0K 0  x 哱0 0 0 ` \ Kd  t K0\0[dS00 KBX\0[ S 00 叱dP Ҳ_fp@-@`P0U 0 VPp@p0@-@P0UP0 040 - B-L|şMx tş( XK GK , 0! 41 %0D%\KI1 0`K,%I1 0dK%V1 0hK%S1 0lK$S1 0|K1 帬 K0K\@K@ K 0 (1 ͷ 0K1 妬KK`0K0 0K ,! 廷 0|K KtK1 J0tK01 08 tK1 Ǭ 0K1 ì 0|K1 忬018AK A I?K$! d K 0KK40@1  @0#T^0@1|KD1 0DMSB00K 01  H! WK0Kh K K0 H1 冻0KK 1 & 0tK 1 L!  00 900 厒KⰫBX0 S  S S! S$ S' S* S- S0 S00 p00 ,0\0 0 00 .000 )000 $000 000 0 00 000 000 _ - B-X2L8MP"p0 L2l X KKd0 h ` ǫ0\K0 0\K00 僟0\0 ë 00 00 ݪ 00 ت 00 Ӫ 00 Ϊ 00 ɪ  00 堫  00 囫00 KBX0 S  S S! S$ S' S* S- S0 S00 ґ00 厫0\0 q0 00 吪000 勪000 冪000 偪000 |0 00 w000 N000 I_8G-pDM0 @ 㱬0@ 0`,04 `8@ 0` (  p 0`p 0 @0xK0 Z SxK00 l xK 0K |K } 01   0SN  00  K00K0 50[S P60 0R  PQ   \V P 1 $1 $0LP00S(1  $!0$b K\00c0 K$@0 0$! 1R $! $0S, 0 (!R   $. $ ) lxK0Svp0S Q |0[S P0xK0 ̲KXB8 0 pl K2, K00Q4  0\S* 0 R 00 X000 0  \  0R Q8  0 0 8凥 000K 41 K040K  0 K0@l0l  1Kb 0 K0@l0dK$0 K$0@0 060 $0 $ $10C$1 00  0x K!; 00   11 vKr  L 0!0 5 !0DX0 S! S 0[! S P11 |0[S<  P X0S  S S S S00 i00 ŕ0\0 娕0 0 壕 00 000 彔00 唕_| T - B-2LlM"0 2 XK K |0  x q2 0 劇0h"V0 Z 00  ߅0 00 r 0 00 PBڬ 0 00 @ ƅ P + tK0  0 0Kl h0K \K X\0 0  0 0 1\   0 R K⏔B ㆖X0S  S S S S00 屬00 0\0 0 0 00 d000 00 ܔ_\ T - B-41L4M,!l0 (1h X KK`0 d \ 应0  00 彔 00 6 00 ד 00 宔00 cK%BX0| S  S S00 Q00 孔0 00 000 宓000 兔_"  - B-41L4M,!l0 (1h X KK`0 d \ d0  00 g 00 00 ⁓ 00 X00 KϓBX0| S  S S00 00 W0 00 巄000 X000 /_.D - B-<1L4M4!l0 01h X KK`0 d \ 0  10  00 ⊄ 00 + 00 00 巫KwBX0| S  S S00 士00 0 00 _000 000 ד_:0@-0@#1C ^P  0n?0!R ^\ L0!0b0C0 0 - B-83LM0ß0 ,3 XK K0  啓 0S000\K0 婅0\K 00 J0\0 劓  0"!0 K t0K l h0K0\KhK0 圞 K 0K | h0K0xKhK0 剞x 0 1 0 00 0 ` 0( KK @ 0K0 K 00 0K  h0KKM 0000 0KxKbxK \0K[00 0x0 0\0 K‒B0K0 0x0 0\0 00 X0S S S S 00 _F - B-2LM"0 2 XK K 0   0S000\K0 Ԅ0\K 00 u0\0 嵒  0"!0 K t0K l h0K \KhKǝ 0K K | h0K0xKhK0 崝0K  K  h0K0hKK0 埝 ]\K x0K屈 Kx0K 嫈  000 U0x0 Q0\0 MKȑBX0S  S S 00 ;0x0 70\0 300 H_T` - B-0L\M 0 0 X KK|0  x 0@hK 00 K0t0Kl 000  \K10\K0 i0\0 KxBXP0\0 P 00 _`0 00C - B-L1L`MD!0 @1 XKK|0  x Ǒ K 0P@ 1S0 0 00"P   K0t0K0l hK0 \K0 ՜P0\K 0 `0\0 堑0 @K0c0BX0\0  向00 契_f(@-P@ Qp`0Ql  0B@-P@ Qp`0Q l 0H - B-LtM Ÿ | XK  K  Kx B0  0 0 S00K,0 e 0S   \KA0\K 00 0\0 "0  0 0KtKl h0K \K 9\0K 000   P  !0 Q00\0 00  P \0  /@ B(\ 0 Pڼ^  00 0\0 ǐKBB\0 0  X00 \屐00 Ɛl_ - B-L7LM 0 <<7( XK K,!  0 劐((0K#101 (!4 0S000\K0 嗂(1\K 00 80\0 x(A4QtK0P  0 0Kl h0K \K 君\,0 < 0D1 0 0 D!`P@ 0#QN(14A@Q !1c UE0 00 000 000 _7 - B-<1L4M4!l0 01h X KK`0 d \ 0 10  0 0 00 00 00 垡ۉK^BX0| S  S S00 务00 0 00 ȉ000 É000 徉_9 - B-LlM  XKK K| x 嚉 00 0 0  Q0K0 B 0d0  `0 \0K t0KO}0  t K/P \0[S dP Q ʊ\0[S dP0X\0[S 00 ndP _;@-@}- 0  - B-L\Mp @KXKl h Kd 0 ` !0\K0 <{ 0   R @0 0 }\AP/\ @K K   0 R 0\000  KfB@K 'P0 \ و00 X0\0  ψ00 _,=-| - B-Ll`Mh d XK K | 0  x 夈 0  0 V}0 AፌP" 0d 0 ` \ K t0K_|tKx \0[S dPKB\0[S dP 00  0Y|҉X\0[S 00 倈dP É_>p@-P@M 0`^࠳0 P @P @Ѝp0 ΈO-4Mp0 0 @PJ(P`0 @$00  ᗎP 0 P k  0@TZ4Ѝ0@0  ̎ - B-0LD-0TP - B-L@Ml XKd Kh `  0 \ 0 0 |0 0 0T0   pK⏅BX|00 00 00 _6DH - B-L@Ml XKd Kh `  0 \ 0 0 t|0 0 0T0   4KSBX|00 00 r00 _<4Iv0@- @Ps0@0@-0 @RP @G0@;0@- P@0 0@- 7 ‘ ⃘ ┘ R s  - B-1LDMl0 0 `0 KX0Kh d0  \ s00  09 0@ 0 ,KB00  x000 0 00 00 00 oX0| S 00 _,KBT - B-1LDMl0 0 `0 KX0Kh d0  \ (00  0 0@ 0 K⟄B00  x000 0 Ց00 00 00 $X0| S 00 _XLJT@-0 S RQ@TQ00R00Sp@-0@`P!  p@O@-0@00@-0@000 A - B-1LDMl0 0 `0 KX0Kh d0  \ 善00  0\ 0@ 0 OK B00  x000 0 C00 $00 00 咄X0| S 00 _NR̸ - B-1LDMl0 0 `0 KX0Kh d0  \ K00  0 0@ 0 KƒB00  x000 0 00 00 00 GX0| S 00 _OZ̸0 AQ00R00Sp@-0@`P!  p@Bz - B-2L@Ml0 2Ÿ `0 KX0Kh d0  \ ݃0 0 o1 0 0T0   ∐ 0 T 0 ,#0 T0 0to 00  ,t000 't 00 't0K 00BX0| S  S S S S00 200 境000 t 00 s0t00 i 00 ,50 00 __Rb - B-2L@Ml0 2Ÿ `0 KX0Kh d0  \ M0 0 1 0 0T0   0 T 0 ,ⓕ0 T0 0tߏ 00  s000 s 00 s0K 00厂BX0| S  S S S S00 00 000 rs 00 ms0t00 ُ 00 ,⥏0 00 Ϗ_HTr - B-1L@M!l0 1h X KK`0 d \ 忂0 00 "S1 0 0 1S0  00 壏媂 0  #R 00 $s 00 s 00 t⋏ 00 ,W 00 ⁏00 3K BX0| S  S S S S00 00 卂000 r000 r0t00 T0,00 0 00 J_\V - B-1L@M!l0 1h X KK`0 d \ :0 00 "S1 0 0 1S0  00 % 0  #R 00 r 00 r 00 t 00 ,Ҏ 00 00 K℁BX0| S  S S S S00 00 000 hr000 cr0t00 ώ0,00 囎0 00 Ŏ_pX - B-1L@M!l0 1h X KK`0 d \ 嵁0 00 "S1 0 0 1S0  00 噎堁 0  #R 00 r 00 r 00 t⁎ 00 ,M 00 w00 )zKBX0| S  S S S S00 00 偁000 q000 q0t00 H0,00 0 00 >_Z0@-P @P 00 00@#1QCUPC1`0 - B-$2LM0 2Ÿ |0 X0KK 0  x  K0K  0Q  0K0 净B0S 0 0 儂 0 0 00K嬍 0Q   Kڬ0 0S 0` \ Kd 00  t0K  a 00t K\0[S dP ) 0 0 J[00 р宀X0S \0[ S 00 dP _]p@-P , `t0@#T0@P0#Tp - B-L2LpMD0 @2 XKK |0  x j R 0 00  0Sڨ0, t0,00 t Q 0` \ Kd  0 t0K T0d 0 `0 0R :\0[S dPKB钁0K0   嬁 0 0K0 Ռ 0 ! 0K 0K嫍0dK 00 0S:X00 0S [\0[S  00  dP S_X` - B-5LfMt1 5şh1  X0KcKp l1 !  d 0 ! 1 1  K$MQ  !BR  KF! 0  D! @1 < 8 4  QK! 剔 ( 01 814 R !0S !81 R! 81 1K0 a1 01  01  1S !  01 01K c K!1! R0K1 cK~B01 P 10S1 0 .KL1 H1KP1 'H1[S PP Kl1SDڠ!  ! 壑 ,坑P$K屑11 S1  K! 冒!Q00à?01 1!0 S1 ! 10S01 !R 1! 01 ~K!z0K1 0K1 !K <0K1 Kf!K /0K1 KY01 S&0K1 /P  @!0 1 01Kh!K0!! 0! 1K!/!Q 0K1 [0K1 W3[0K1 O0K1 K0K1 G01 ~y~X1S S S S H1[ S PP!! _fA-p0 `ΐP nn0S@TPᲑ 0PS@Q-M 0Ѝ0@- MP0 @P80 Ѝ0 0.0 - B-LŸlM Ÿ0 X KK|  0 x }0  0B S0#03tKm 0 0 0"!PB0S 0B1`Q  0 !R K0K ``P H0 0 Ɍ00t K0 Q 0 0S \0[S dPK4}B 0#1C RQʰ Q ʬ 0!0 P0000l0 ! mn\ 0 c00 X\0[S 00 }dP ~_j0O0@-P@U  ~PPdP0O-M   p  Q @`Dn[ @ 9P 0@ 0PP ef 80 ~0P UP0 mpWJpW` Z0#V!0`V 00ЍO-锰0# Qp@00 0SM0@1 Yb a P0@`T ډ|PU mZ   m0#W!0pW0j0Ѝ - B-4LM$0 4 X KK|0  x | 0 S"!   0S S 01S 0 R\  0t ,   0 0    < 00 L \f K0K" 0 0S0P#0 0!S  dS |0S  Q  R` \\Kd \v Rڬ0, 嫏 t0K> 0! 0S0  | 0 0t K0 \0[S dPF Q 00 0 00 ' 0Sڬ ,  婐0t00 0SK`{BX0, 0S0S 0S0S )}0 ,0 6 0B0 00 0 0,0   ^00  X\0[S 00 {dP |_r'@B@-@00D@-@00D-@@P@-@@0S00 - B-1LXM0 0 X KK |0 x  Q{ 0C\ 00  03KzB00 t K 0` \Kd %\0[S dP |X\0[ S 00 H{dP |_s - B-1LDMt0 0 h0 KX0Kp l0  d {0\K 00 i0`K 00 i`0\K0 ij0 `K0 *i0\K0 &iKszBX00 0S0\K0 i00 z0`K0 i_t - B-L\M X KK 0 | x  z 0 CR 00  0^K7zB0d 0 ` \ Kt K0P\0[S dP |X\0[ S 00 zdP {_u - B-1L - B-3LdMx#p0 t3l X KKd0 h `  t 0B0CScPDDDDDDDDDDDDDD0T0 _v 00  0 00 KMtB00 Mv0  0 W00T0 Av0  0 M  0T0 4v0  0 00T0 (v0  0 W 00 v0  0 0T0 v 0 0Kt I\Kmq  \K0x0 \K0 Ks0080 u0  0 0000 wtUt000000X0 S  S S S S S S S 0\K0 Ps0[ _HtD@PTdlddlddTdddddd\ddlB@P&$$$$ܐ$$ $$$$$$$$,!x - B-0L4M l0 0h X KK`0 d \ s0  l00 z00 [sK/sBX|00 00 N00 s_^đ - B-0L4M l0 0h X KK`0 d \ s0  d00 H00 )KrBX|00 00 00 s_d - B-0L8M l0 0h X KK`0 d \ Us0 0 p000h 00 00 KrBX| 00 00 Zs_jTT - B-0L8M l0 0h X KK`0 d \ s0  t000 0 00 sKrBX| 00 00 %s_p( - B-0L8M l0 0h X KK`0 d \ r0 0 p000h 00 00 KbrBX| 00 00 r_v - B-0L8M l0 0h X KK`0 d \ r0  t000 0 x00 YrK-rBX| 00 L00 r_|̕ - B-0L8M l0 0h X KK`0 d \ r0 0 p000h 00 B00 #KqBX| 00 00 r_̸ - B-0L8M l0 0h X KK`0 d \ Nr0  t000 0 00 ArKqBX| 00 00 Sr_p 0-0VD0@-0@O@ rDpD-@@ q4 400bCT*`P@ET:pIpYpYD0D 0D-@ cBAT 0@D PT@D0DpYpY(I@-(0 @Cr 004s|--stcl_rcFileName~/.tclshrclibrarypathpwb1.1incr argc -1; set argv [lrange $argv 1 end]proc tclKitInit {} { rename tclKitInit {} load {} Mk4tcl mk::file open exe [info nameofexecutable] -readonly set n [mk::select exe.dirs!0.files name boot.tcl] if {$n != ""} { set s [mk::get exe.dirs!0.files!$n contents] if {![string length $s]} { error "empty boot.tcl" } catch {load {} zlib} if {[mk::get exe.dirs!0.files!$n size] != [string length $s]} { set s [zlib decompress $s] } } else { set f [open setup.tcl] set s [read $f] close $f } uplevel #0 $s } tclKitInitargv0Mk4tclrechanvfszlib~/.tclkitrcerrorInfoif {[file isfile [file join [info nameofexe] main.tcl]]} { if {[info commands console] != {}} { console hide } set tcl_interactive 0 incr argc set argv [linsert $argv 0 $argv0] set argv0 [file join [info nameofexe] main.tcl] } else continue filldraincountadler32crc32compressdeflatedecompressinflatesdecompresssinflateoption data ?...?1.2.3writeclosecommand moderechan%d-bufferingnone-blockingTcl8.41.0::tcl::clock::clicks::tcl::clock::getenv::tcl::clock::microseconds::tcl::clock::milliseconds::tcl::clock::seconds::tcl::clock::Localtime::tcl::clock::Mktime::tcl::clock::Oldscan::tcl::chan::Truncate::tcl::chan::rCreate::tcl::chan::rPostevent::tcl::Bgerror::tcl::unsupported::EncodingDirs::tcl::mathfunctcl_platformbyteOrderlittleEndianwordSizetcl_patchLevel8.5a48.5tcl_versiontcl_precisionCan't create math function namespaceTcl_CreateInterp: builtin command with NULL object command proc and a NULL compile proc Tcl_CreateInterp: can't create global namespaceappendbinarybreakcasecatchconcatcontinuedictencodingevalexitexprfcopyfileeventforforeachformatglobalincrinfojoinlappendlassignlinsertllengthloadlrangelrepeatlreplacelsearchlsetlsortpackageregexpregsubreturnscansplitsubstswitchtraceunloadunsetuplevelwhileaftercdeoffblockedfconfigureflushgetsglobopenpidputspwdtellupdatevwaitexecsource::tcl::mathfunc::abs::tcl::mathfunc::acos::tcl::mathfunc::asin::tcl::mathfunc::atan::tcl::mathfunc::atan2::tcl::mathfunc::bool::tcl::mathfunc::ceil::tcl::mathfunc::cos::tcl::mathfunc::cosh::tcl::mathfunc::double::tcl::mathfunc::entier::tcl::mathfunc::exp::tcl::mathfunc::floor::tcl::mathfunc::fmod::tcl::mathfunc::hypot::tcl::mathfunc::int::tcl::mathfunc::log::tcl::mathfunc::log10::tcl::mathfunc::pow::tcl::mathfunc::rand::tcl::mathfunc::round::tcl::mathfunc::sin::tcl::mathfunc::sinh::tcl::mathfunc::sqrt::tcl::mathfunc::srand::tcl::mathfunc::tan::tcl::mathfunc::tanh::tcl::mathfunc::wideerrorCodeAssoc Data Key #%dDeleteInterpProc called with active evalsDeleteInterpProc called on interpreter not marked deleted::cannot use namespace qualifiers in hidden command token (rename)can only hide global namespace commands (use rename then hide)hidden command named "" already existscan not expose to a namespace (use expose to toplevel, then rename)trying to expose a non global command name space commandexposed command "unknown hidden command "can't rename to "": bad command name": command already existsdelete": command doesn't existcan't ::tcl::mathfunc::attempt to create a math function with too many argsargument to math function didn't have numeric valuetcl::mathfunc::unknown math function "*[]]?\too many nested evaluations (infinite loop?)attempt to call eval in deleted interpreterCOREIDELETE::unknowninvalid command name "while executing... %s "%.*s%s"invoked from within (expanding word %d)command returned bad code: %dinvoked "continue" outside of a loopinvoked "break" outside of a loopinvalid hidden command name "TclObjInvoke: called without TCL_INVOKE_HIDDENillegal argument vectorNONEtoo few arguments for math function "manybytearrayTcl_SetByteArrayObj called with shared objectTcl_SetObjLength called with shared objectvalue formatString ?varName varName ...?not enough arguments for all format specifiersmissing count for "@" field specifierbad field specifier "formatString ?arg arg ...?" insteadexpected string but got "hexadecimalnumber of elements in list does not match countcannot use "*" in format string with "x"option ?arg arg ...?unexpected fall-throughunexpected fallthrough0123456789abcdefunable to alloc %u bytesunable to alloc %u bytes, %s line %dunable to realloc %u bytesunable to realloc %u bytes, %s line %dvariable not foundsecondsnumber too large to represent as a Posix timeCLOCKargTooLargelocaltime failed (clock value may be too large/small to represent)localtimeFailedyear month day hour minute secondtime value too large/small to represent-milliseconds-microseconds?option?TZ ("%.50s" arm line %d)defaultextra case pattern with no bodystring ?in? patList body ... ?default body?couldn't save return options in variablecouldn't save command result in variable ("catch" body line %d)script ?resultVarName? ?optionVarName?couldn't change working directory to "~?dirName?convertfromconverttonamessystem?encoding? data?encoding?option ?arg ...?expected directory list but got "?dirList?-code error -level 0-errorcodemessage ?errorInfo? ?errorCode? ("eval" body line %d)arg ?arg ...??returnCode?atimechannelscopydirnameexecutableexistsextensionisdirectoryisfilelstatmtimemkdirnativenamenormalizeownedpathtypereadablereadlinkrootnameseparatorsizestattailvolumeswritable-symbolic-hardname ?time?accesscould not set time for file "modification?pattern?name ?name ...?could not create new link "" pointing to "": no such file or directory" doesn't exist": target "": that path already existscould not read link "?-linktype? linkname ?target?name varNamefilenamevolumerelativeabsoluterelativecould not readlink "Unrecognised path/?name?could not read "devinonlinkuidgidctimeunknownfifoblockSpecialcharacterSpecialstart test next command ("for" initial command) ("for" loop-end command) ("for" body line %d)varList list ?varList list ...? command ("foreach" body line %d)couldn't set loop variable: "Tcl_ForeachObjCmd: could not reconvert value list %d to a list object Tcl_ForeachObjCmd: could not reconvert variable list %d to a list object foreach varlist is empty" argumentthenelseifelsewrong # args: extra words after "else" clause in "if" commandwrong # args: no script following "else" argumentwrong # args: no script following "wrong # args: no expression after "varName ?increment?cmdcountcompletefunctionsglobalshostnamelevelloadedlocalsnameofexecutablepatchlevelprocsscriptsharedlibextensiontclversionvarsprocname" isn't a procedureprocname arg varnameprocedure "" doesn't have an argument "couldn't store default value in variable "varNameunable to determine name of host?number?bad level "tcl_libraryno library has been specified for Tcl?interp??filename?.solist ?joinString?list varname ?varname ...?list ?index...?list index element ?element ...?list first lastpositiveCount value ?value ...?must have a count of at least 1list first last ?element element ...?list doesn't contain element -all-ascii-decreasing-dictionary-exact-glob-increasing-index-integer-nocase-not-real-regexp-sorted-start-subindices-subindices cannot be used without -index option (-index option item number %d)"-index" option must be followed by list indexmissing starting index?options? list patternlistVar index ?index...? value-command-indices-unique"-command" option must be followed by comparison command"-index" option must be ?options? list (-compare command)-compare command returned non-integer result%ldelement missing from sublist "fall-out when searching for body to match patternno body specified for pattern "extra switch pattern with no bodydocumentation, this may be due to a comment incorrectly placed outside of a switch body - see the "switch" ?switches? string {pattern body ... ?default body?}-matchvar option requires -regexp option-indexvar option requires -regexp option?switches? string pattern body ... ?default body? option already foundmissing variable name argument to -matchvar optionmissing variable name argument to -indexvar option-about-expanded-linestop-lineanchor--couldn't set variable "regexp match variables not allowed when using -inline?switches? exp string ?matchVar? ?subMatchVar subMatchVar ...?*+?{}()[].\|^$?switches? exp string subSpec ?varName?oldName newName-encoding?-encoding name? fileNamestring ?splitChars? bytelengthcompareequalfirstindexlastmapmatchrepeatreplacetolowertouppertotitletrimtrimlefttrimrightwordendwordstartalnumalphaasciibooleandigitdoublefalsegraphlowerprintpuncttrueupperwideintegerwordcharxdigit-length?-nocase? ?-length int? string1 string2": must be -nocase or -lengthsubString string ?startIndex?string charIndexclass ?-strict? ?-failindex var? strclass-strict-failindex?-strict? ?-failindex var? str": must be -strict or -failindexchar map list unbalancedbad option "": must be -nocase?-nocase? charMap string?-nocase? pattern stringstring first laststring countstring size overflow, must be less than %dstring first last ?string?string ?first? ?last?string ?chars? string indexoption arg ?arg ...?-nobackslashes-nocommands-novariablesTcl_SubstObjCmd: bad option index to SubstOptions?-nobackslashes? ?-nocommands? ?-novariables? string-indexvar-matchvar ("%.*s%s" arm line %d)command ?count?microsecondsiterationtest command ("while" body line %d)ForeachInfoTclCompileCatchCmd: bad jump distance %d getTclCompileIfCmd: unexpected opcode "%d" updating ifFalse jump-optionsunknown switch mode: %dUnexpected token type in TclCompileTokensdonepush1push4popdupconcat1invokeStk1invokeStk4evalStkexprStkloadScalar1loadScalar4loadScalarStkloadArray1loadArray4loadArrayStkloadStkstoreScalar1storeScalar4storeScalarStkstoreArray1storeArray4storeArrayStkstoreStkincrScalar1incrScalarStkincrArray1incrArrayStkincrStkincrScalar1ImmincrScalarStkImmincrArray1ImmincrArrayStkImmincrStkImmjump1jump4jumpTrue1jumpTrue4jumpFalse1jumpFalse4lorlandbitorbitxorbitandneqgtlshiftrshiftaddsubmultdivmoduplusuminusbitnotnotcallBuiltinFunc1callFunc1tryCvtToNumericforeach_start4foreach_step4beginCatch4endCatchpushResultpushReturnCodestreqstrneqstrcmpstrlenstrindexstrmatchlistIndexlistLengthappendScalar1appendScalar4appendArray1appendArray4appendArrayStkappendStklappendScalar1lappendScalar4lappendArray1lappendArray4lappendArrayStklappendStklindexMultioverlsetListlsetFlatreturnImmexponexpandStartexpandStkTopinvokeExpandedlistIndexImmlistRangeImmstartCommandlistInlistNotInpushReturnOptsreturnStkdictGetdictSetdictUnsetdictIncrImmdictAppenddictLappenddictFirstdictNextdictDonedictUpdateStartdictUpdateEndbytecodereturn -code 1 -level 0 -errorinfo while executing "-errorlineEnterCmdStartData: bad command index %d EnterCmdStartData: cmd map not sorted by code offsetEnterCmdExtentData: bad command index %d EnterCmdExtentData: missing start data for command %d TclFixupForwardJump: bad ExceptionRange type %d GetCmdLocEncodingSize: bad source lengthGetCmdLocEncodingSize: bad code lengthGetCmdLocEncodingSize: bad code offsetEncodeCmdLocMap: bad source lengthEncodeCmdLocMap: bad code lengthEncodeCmdLocMap: bad code offset  !!!!!!!!!!""###$%%&&&&&''((()**536"412 +0  !-($.*#7&%/, )87'C &  #(/-.)02,1+3678;<=9>?'5@.6 ( N @0!)"*#/2;AB=1 +$%<&,3-4: 8 7>9? DFHIJEGKLMQRPO     -0     H  !"#$%&'() ( (  ((**syntax errorparser stack overflowjanuaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaytuesdaytueswednesdaywednesthursdaythurthursfridaysaturdayyearmonthfortnightweekhourminuteminsecondsectomorrowyesterdaytodaynowthisnextagoepochstardategmtutcwetbstwatnftnstndtadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetcestmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastwadtjtcctjstjdtkstkdtcastcadteasteadtgstnztnzstnzdtidledstvza.m.p.m.stringToParse baseYear baseMonth baseDaymore than one ordinal month in stringmore than one weekday in stringmore than one time zone in stringmore than one time of day in stringmore than one date in stringmissing value to go with keykey "" not known in dictionaryTcl_DictObjPut called with shared objectTcl_DictObjRemove called with shared objectconcurrent dictionary modification and searchTcl_DictObjPutKeyList called with empty key listTcl_DictObjPutKeyList called with shared objectTcl_DictObjRemoveKeyList called with empty key listTcl_DictObjRemoveKeyList called with shared object?key value ...?dictionary ?key key ...?dictionary ?key value ...?dictionary ?key ...?dictionary ?pattern?dictionarydictionary key ?key ...?varName key ?increment? (reading increment)varName key ?value ...?{keyVar valueVar} dictionary scriptmust have exactly two variable names ("dict for" body line %d)couldn't set value variable: "couldn't set key variable: "varName key ?key ...? valuevarName key ?key ...?dictionary filterType ...filterTypedictionary value globPatterndictionary key globPatterndictionary script {keyVar valueVar} filterScript ("dict filter" script line %d)varName key varName ?key varName ...? script (body of "dict update")dictVar ?key ...? script (body of "dict with")createfilterkeysmergeremovevalueswithsubcommandunexpected fallthrough!subcommand ?arg ...?*.encidentityutf-8unicode.encunknown encoding "invalid encoding file "initfinalEscapeToUtfProc: invalid sub tableenvHOMEno such variabletclBgErrorerror in background error handler: msg optionsbgerrorbgerror failed to handle background error. Original error: Error in bgerror: TclSetBgErrorHandler: NULL cmdPrefix argumentAppExitProc returned unexpectedlyTclInitSubsystems called while finalizingexit handlers were created during Tcl_Finalizecan't wait for variable "": would wait foreveridletasks?idletasks?Tcl_UpdateObjCmd: bad option index to UpdateOptions||&&|^&==!=<><=>=<<>>+*BUILTIN FUNCTIONdictIteratorERROR: freeing an execEnv whose stack is still in use. Tcl_ExprObj: compiled expression jumped interpsTcl_EvalObj: compiled script jumped interpsshared object passed to TclIncrObj TclExecuteByteCode: abnormal return at pc %u: stack top %d < entry stack top %d TclExecuteByteCode execution failure: end stack top < start stack topTclExecuteByteCode: unrecognized opCode %udivide by zeroARITHDIVZERO (reading value of variable to increment)integer value too large to representnegative shift argumentTclExecuteByteCode: obsolete INST_CALL_BUILTIN_FUNC1 foundTclExecuteByteCode: obsolete INST_CALL_FUNC1 foundexponentiation of zero by negative powerDOMAINexponent too largeShould not happen!mis-issued dictFirst!mis-issued dictNext!mis-issued dictDone!dictUpdateStart argument length mismatchempty stringcan't use %s as operand of "%s"invalid octal numbernon-numeric string(big) integernon-numeric floating-point value**domain error: argument not in valid rangefloating-point value too small to representUNDERFLOWfloating-point value too large to representOVERFLOWunknown floating-point error, errno = %dUNKNOWNcopyingerror " is not a directory: target "renamingwrong # args: should be " ?options? source ?source ...? target"can't create directory "error deleting "error deleting unknown file: ": directory not empty ?options? file ?file ...?"" to "": "can't unlink "::tcl::CopyDirectory": trying to rename a volume or error renaming "move a directory into itselfu+w-permissionscan't overwrite directory "" with file "can't overwrite file "" with directory "-force": should be -force or --name ?option? ?value? ?option value ...?value for "" missing", there are no file attributes in this filesystem.only one MacOS type or creator argument to "-types" allowedcreatorbad argument to "-types": \[]*?{}"-tails" must be used with either "-directory" or "-path"?switches? name ?name ...?"-directory" cannot be used with "-path"missing argument to "-directory""-path" cannot be used with "-directory"missing argument to "-path"missing argument to "-types"//.//\:couldn't find HOME environment variable to expand pathuser "-directory-join-nocomplain-path-tails-typesreadonlyhiddenmacintoshno files matched glob pattern/\*[]?\unmatched close-brace in file nameunmatched open-brace in file namemalformed bucket chain in Tcl_DeleteHashEntry%d entries in table, %d buckets number of buckets with %d entries: %d number of buckets with %d or more entries: %d average search distance for entry: %.1fcalled Tcl_FindHashEntry on deleted tablecalled Tcl_CreateHashEntry on deleted tablebad ambiguous ": must be , can't convert value to index except via Tcl_GetIndexFromObj API or "if {[info proc tclInit]==""} { proc tclInit {} { global tcl_libPath tcl_library env tclDefaultLibrary rename tclInit {} if {[info exists tcl_library]} { set scripts {{set tcl_library}} } else { set scripts {} if {[info exists env(TCL_LIBRARY)] && ($env(TCL_LIBRARY) ne {})} { lappend scripts {set env(TCL_LIBRARY)} lappend scripts { if {[regexp ^tcl(.*)$ [file tail $env(TCL_LIBRARY)] -> tail] == 0} continue if {$tail eq [info tclversion]} continue file join [file dirname $env(TCL_LIBRARY)] tcl[info tclversion]} } if {[info exists tclDefaultLibrary]} { lappend scripts {set tclDefaultLibrary} } else { lappend scripts {::tcl::pkgconfig get scriptdir,runtime} } lappend scripts { set parentDir [file dirname [file dirname [info nameofexecutable]]] set grandParentDir [file dirname $parentDir] file join $parentDir lib tcl[info tclversion]} \ {file join $grandParentDir lib tcl[info tclversion]} \ {file join $parentDir library} \ {file join $grandParentDir library} \ {file join $grandParentDir tcl[info patchlevel] library} \ { file join [file dirname $grandParentDir] tcl[info patchlevel] library} if {[info exists tcl_libPath] && [catch {llength $tcl_libPath} len] == 0} { for {set i 0} {$i < $len} {incr i} { lappend scripts [list lindex \$tcl_libPath $i] } } } set dirs {} set errors {} foreach script $scripts { lappend dirs [eval $script] set tcl_library [lindex $dirs end] set tclfile [file join $tcl_library init.tcl] if {[file exists $tclfile]} { if {[catch {uplevel #0 [list source $tclfile]} msg opts]} { append errors "$tclfile: $msg " append errors "[dict get $opts -errorinfo] " continue } unset -nocomplain tclDefaultLibrary return } } unset -nocomplain tclDefaultLibrary set msg "Can't find a usable init.tcl in the following directories: " append msg " $dirs " append msg "$errors " append msg "This probably means that Tcl wasn't installed properly. " error $msg } } tclInitinterpInterpInfoDeleteProc: still exist aliasesInterpInfoDeleteProc: still exist commandsaliasaliasesexposehideissafeinvokehiddenmarktrustedrecursionlimitslavessharetargettransfer-safe-global-namespaceslavePath slaveCmd ?masterPath masterCmd? ?args ..?path ?cmdPrefix?interp%d?-safe? ?--? ?path?cannot delete the current interpreterpath arg ?arg ...?path hiddenCmdName ?cmdName?path cmdName ?hiddenCmdName?path ?-namespace ns? ?-global? ?--? cmd ?arg ..?path limitType ?options?limit typepathpath ?newlimit?srcPath channelId destPathpath alias" is not my descendanttarget interpreter for alias "" in path "" not foundcmd ?arg ...??path?cannot define or rename alias "": would create a loop": interpreter deletedcould not find interpreter "cmdPrefix must be list of length >= 1tcl_interactiveclockinterpreter named "" already exists, cannot createaliasName ?targetName? ?args..??cmdPrefix?hiddenCmdName ?cmdName?cmdName ?hiddenCmdName??-namespace ns? ?-global? ?--? cmd ?arg ..?limitType ?options??newlimit?SlaveObjCmd: interpreter has been deletedpermission denied: safe interpreter cannot expose commandspermission denied: safe interpreters cannot change recursion limitfalling back due to new recursion limitrecursion limit must be > 0permission denied: safe interpreter cannot hide commandsnot allowed to invoke hidden commands from safe interpreterpermission denied: safe interpreter cannot mark trustedososVersionmachineusertclDefaultLibrarytcl_pkgPathtime limit exceededcommand count limit exceededunknown type of resource limit (while waiting for event)limit granularity must be positiveinstalling limit callback to the limited interpreter-granularity-valuecommand limit value must be at granularity must be at ?-option? ?value? ?-option value ...?-secondsmay only set -milliseconds if -seconds is not also being resetmay only reset -milliseconds if -seconds is also being resetmilliseconds must be at least 0seconds must be at least 0tclIOTcl_RegisterChannel: duplicate channel namesTcl_RegisterChannel: channel without nameIllegal recursive call to close through close-handler of channelcan not find channel named "stdinstdoutstderrTcl_CreateChannel: NULL channel namecould not flush channel "reading and writing both disallowed for channel "couldn't find state for channel "unable to access channel: invalid channelTclFlush, closed channel: queued output leftFlushChannel: damaged channel listSpliceChannel: trying to add channel used in different listcalled Tcl_Close on channel with refCount > 0iso8859-1blocking buffering buffersize encoding eofchar translation": should be one of or -malformed option list in channel driver-translationlfautocrlfcr-eofchar%c-buffersizefullunable to set channel options: background copy in progressbad value for -translation: must be a one or two element listbad value for -translation: must be one of auto, binary, cr, lf, crlf, or platformbad value for -eofchar: should be a list of zero, one, or two elementsbad value for -buffering: must be one of full, line, or nonechannelId event ?script?event namechannel is not " is busyerror writing "error reading "unknown eol translation modeTcl_Write: unknown output translation modeTcl_Write: AUTO output translation mode not supportederror setting blocking mode: -code-levelTcl_SetChannelError(Interp): Bad syntax of message?-nonewline? ?channelId? string" wasn't opened for writing-nonewlinebad argument "": should be "nonewline"nonewlinechannelIderror flushing "channelId ?varName?" wasn't opened for readingchannelId ?numChars??-nonewline? channelIdcurrentchannelId offset ?origin?error during seek on "originchannelId ?optionName? ?value? ?optionName value?...-keepnewline?switches? arg ?arg ...?error reading output from command: Tcl_OpenCmd: invalid mode valuefileName ?access? ?permissions?tclTCPAcceptCallbacksRegisterTcpServerCleanup: damaged accept record table-async-myaddr-myport-server?-myaddr addr? ?-myport myport? ?-async? host port-server command ?-myaddr addr? porttcpoption -myport is not valid for serverscannot set -async option for server socketsTcl_SocketObjCmd: bad option index to SocketOptionsno argument given for -myaddr optionno argument given for -myport optionno argument given for -server option-sizeinput output ?-size size? ?-command callback?error during truncate on "could not determine current location in "cannot truncate to negative length of filechannelId ?length?tclrchannelblockingcgetcgetallconfigurefinalizeinitializewatch{read not supported by Tcl driver}{read delivered more than requested}{write not supported by Tcl driver}{write wrote more than requested}{Tried to seek before origin}mode cmdprefixInitialize failure: 'cget' not supported, but should be, as 'cgetall' is'cgetall' not supported, but should be, as 'cget' isWriting not supported, but requestedReading not supported, but requestedNot all required methods supportedchannel eventspec" is not a reflected channelpostevent for channel "" called from outside interpretertried to post events channel "" is not interested inTclChanCaughtErrorBypass: Bad syntax of caught resultExpected list with even number of elements, got %d element%s instead list: is emptyread writerc%lucouldn't open socket: port number too highcouldn't read file "nativeglob couldn't determine the current working directoryillegal access mode "BINARYaccess mode must include either RDONLY, WRONLY, or RDWRinvalid access mode "": must be RDONLY, WRONLY, RDWR, APPEND, BINARY, CREAT, EXCL, NOCTTY, NONBLOCK, or TRUNCTRUNCNOCTTYNONBLOCKEXCLCREATAPPENDWRONLYRDONLY while processing open access modes " (file "%.*s%s" line %d)could not seek to end of file while opening "couldn't open "error getting working directory name: couldn't load library "couldn't load from current filesystem0700couldn't create temporary file: wbrbTcl_FSGetFileSystemForPath called with object with refCount == 0Tcl_FSGetFileSystemForPath called with NULL objectNot enough memory to create the list Cannot allocate enough memory for Tcl_SetListObjTcl_SetListObj called with shared objectTcl_ListObjAppendList called with shared objectNot enough memory to allocate listTcl_ListObjAppendElement called with shared objectTcl_ListObjReplace called with shared objectlist index out of rangeTcl_ListObjSetElement called with shared objectSetListFromAny: bad size estimate for listNot enough memory to allocate the list internal repstring representation size exceeds sane boundsliteral without a string repfileName ?packageName? ?interp?tclLoadcan't use package in a safe interpreter: no _SafeInit procedure_Init_SafeInit_Unload_SafeUnloadcouldn't find procedure couldn't figure out package name for " isn't loaded statically" is already loaded for package "must specify either file name or package name-keeplibrary?switches? fileName ?packageName? ?interp?" cannot be unloaded: filesystem does not support unloading" cannot be unloaded under a safe interpreter" cannot be unloaded under a trusted interpreter" has never been loaded in this interpreter" has never been loaded" is loaded statically and cannot be unloaded{ {argcargvexit %dapplication-specific initialization failed: tcl_prompt1 (script that generates prompt)% tcl_prompt2nsNameensembleCommandTrying to push call frame for dead namespacecan't create namespace "": already existscan't create namespace "": only global namespace can have empty nameinvalid export pattern "": pattern can't specify a namespaceauto_importempty import pattern" into itselfimport pattern "" tries to import from namespace "no namespace specified in import pattern "unknown namespace in import pattern "can't import command "" would create a loop containing command "unknown namespace in namespace forget pattern "DeleteImportedCmd: did not find cmd in real cmd's list of import referencesCould not create namespace '%s'unknown namespace "unknown command "unknown variable "childrenensembleexportforgetimportinscopeparentqualifierswhich" in namespace children command?name? ?pattern?arg::namespace" in namespace delete command?name name...?name arg ?arg...? (in namespace eval "%.*s%s" script line %d)-clear?-clear? ?pattern pattern...??pattern pattern...??-force? ?pattern pattern...?" in inscope namespace command (in namespace inscope "%.*s%s" script line %d)" in namespace parent command?pathList?-variable?-command? ?-variable? name-map-prefixes-subcommands-unknowntried to manipulate ensemble of deleted namespaceunexpected ensemble commandcmdnamecmdname ?opt? ?value? ...ensemble subcommand implementations must be non-empty listsoption -namespace is read-onlycommand is not an ensemble" is not an ensemble command while parsing result of ensemble unknown subcommand handlerunknown subcommand handler deleted its ensembleunknown subcommand handler returned bad code: result of ensemble unknown subcommand handler: (ensemble unknown subcommand handler) does not export any commandsunknown subcommand "": namespace or ambiguous unknown or full name %s not found in supposedly synchronized hashensemble activated for deleted namespacesubcommand ?argument ...?intwideIntbignumcmdNamemay not convert object to type %sUpdateStringProc should not be invoked for type %sTcl_SetBooleanObj called with shared objectboolean valueexpected boolean value but got "yesnooffTcl_SetDoubleObj called with shared objectfloating point value is Not a Numberfloating-point numberTcl_SetIntObj called with shared objectTcl_SetLongObj called with shared objectIOVERFLOWexpected integer but got "%lldTcl_SetWideIntObj called with shared objectinitialization failure in DupBignumconversion failure in UpdateStringOfBignumUpdateStringOfBignum: string length limit exceededradix size failure in UpdateStringOfBignumTcl_GetBignumAndClearObj called on shared Tcl_ObjTcl_SetBignumObj called with shared object @@can't parse a NULL pointerextra characters after close-braceextra characters after close-quoteParseTokens encountered unknown charactermissing close-bracketmissing )missing close-brace for variable name$missing close-brace: possible unbalanced brace in commentmissing "bad parse in Tcl_SubstObj: %cTcl_SubstObj: programming errorunexpected token type in TclSubstTokens: %dBad portion to TclPathPartcan't find objectstring representationCalled UpdateStringOfFsPath with invalid objectcouldn't can't specify "" as last word in command" wasn't opened for %luCHILDSTATUSchild process exited abnormallyerror reading stderr output file: CHILDKILLEDchild killed: CHILDSUSPchild suspended: error waiting for process to exit: child process lost (is SIGCHLD ignored or trapped?)couldn't create pipe: couldn't create error file for command: couldn't create output pipe for command: couldn't create input file for command: couldn't create input pipe for command: must specify "illegal use of | or |& in commandpipe for command could not be createdcan't write input to command: standard input was redirectedcan't read output from command: standard output was redirected, then conflicting versions provided for package " ("package unknown" script) -exact{}version conflict for package "": have , need can't find package ("package ifneeded" script)Cannot load package "" in standalone executable: This package is not compiled with stub support is not presentpackage ifneededproviderequirevcompareversionsvsatisfiesTcl_PackageObjCmd: bad option index to pkgOptionspackage version ?script??-exact? package ?version?package ?version??command?version1 version2expected version number but got "includedir,runtime/home/steve/noarch/includedocdir,runtime/home/steve/noarch/manlibdir,installbindir,installscriptdir,installincludedir,installdocdir,installthreadedprofiled64bitoptimizedmem_debugcompile_debugcompile_statslibdir,runtime/home/steve/install/server/libbindir,runtime/home/steve/install/server/binscriptdir,runtimetclE2BIGEPERMENOENTESRCHEINTREIOENXIOENOEXECEBADFECHILDEAGAINENOMEMEACCESEFAULTENOTBLKEBUSYEEXISTEXDEVENODEVENOTDIREISDIREINVALENFILEEMFILEENOTTYETXTBSYEFBIGENOSPCESPIPEEROFSEMLINKEPIPEEDOMEDEADLKENAMETOOLONGENOLCKENOSYSENOTEMPTYELOOPENOMSGEIDRMECHRNGEL2NSYNCEL3HLTEL3RSTELNRNGEUNATCHENOCSIEL2HLTEBADEEBADREXFULLENOANOEBADRQCEBADSLTEBFONTENOSTRENODATAETIMEENOSRENONETENOPKGEREMOTEENOLINKEADVESRMNTECOMMEPROTOEMULTIHOPEDOTDOTEBADMSGEOVERFLOWENOTUNIQEBADFDEREMCHGELIBACCELIBBADELIBSCNELIBMAXELIBEXECEUSERSENOTSOCKEDESTADDRREQEMSGSIZEEPROTOTYPEENOPROTOOPTEPROTONOSUPPORTESOCKTNOSUPPORTENOTSUPEPFNOSUPPORTEAFNOSUPPORTEADDRINUSEEADDRNOTAVAILENETDOWNENETUNREACHENETRESETECONNABORTEDECONNRESETENOBUFSEISCONNENOTCONNESHUTDOWNETOOMANYREFSETIMEDOUTECONNREFUSEDEHOSTDOWNEHOSTUNREACHEALREADYEINPROGRESSESTALEEUCLEANENOTNAMENAVAILunknown errorEREMOTEIOEDQUOTargument list too longnot ownerno such file or directoryno such processinterrupted system callI/O errorno such device or addressexec format errorbad file numberno childrenresource temporarily unavailablenot enough memorypermission deniedbad address in system call argumentblock device requiredfile busyfile already existscross-domain linkno such devicenot a directoryillegal operation on a directoryinvalid argumentfile table overflowtoo many open filesinappropriate device for ioctltext file or pseudo-device busyfile too largeno space left on deviceinvalid seekread-only file systemtoo many linksbroken pipemath argument out of rangemath result unrepresentableresource deadlock avoidedfile name too longno locks availablefunction not implementeddirectory not emptytoo many levels of symbolic linksno message of desired typeidentifier removedchannel number out of rangelevel 2 not synchronizedlevel 3 haltedlevel 3 resetlink number out of rangeprotocol driver not attachedno CSI structure availablelevel 2 haltedbad exchange descriptorbad request descriptormessage tables fullanode table overflowbad request codeinvalid slotbad font file formatnot a stream deviceno data availabletimer expiredout of stream resourcesmachine is not on the networkpackage not installedpathname hit remote file systemlink has be severedadvertise errorsrmount errorcommunication error on sendprotocol errormultihop attemptedcross mount pointnot a data messagefile too bigname not unique on networkfile descriptor in bad stateremote address changedcan not access a needed shared libraryaccessing a corrupted shared library.lib section in a.out corruptedattempting to link in more shared libraries than system limitcan not exec a shared library directlytoo many userssocket operation on non-socketdestination address requiredmessage too longprotocol wrong type for socketbad protocol optionprotocol not supporedsocket type not supportedoperation not supportedprotocol family not supportedaddress family not supported by protocol familyaddress already in usecan't assign requested addressnetwork is downnetwork is unreachablenetwork dropped connection on resetsoftware caused connection abortconnection reset by peerno buffer space availablesocket is already connectedsocket is not connectedcan't send afer socket shutdowntoo many references: can't spliceconnection timed outconnection refusedhost is downhost is unreachableoperation already in progressoperation now in progressstale remote file handlestructure needs cleaningnot a name filenot availableremote i/o errordisk quota exceededSIGABRTSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMunknown signalSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYShangupinterruptquit signalillegal instructiontrace trapbus errorfloating-point exceptionkill signaluser-defined signal 1segmentation violationuser-defined signal 2write on pipe with no readersalarm clocksoftware termination signalchild status changedcontinue after stopstopstop signal from ttybackground tty readbackground tty writeurgent I/O conditionexceeded CPU time limitexceeded file size limitvirtual time alarmprofiling alarmwindow changedinput/output possible on filepower-fail restartbad argument to system callTcl_Release couldn't find reference for 0x%xTcl_EventuallyFree called twice for 0x%x a precompiled script jumped interpsprocbodylevelReferencename args bodycan't create procedure "" in non-global namespace with name starting with ":"": bad procedure name": unknown namespaceprocedure "%s": formal parameter %d is inconsistent with precompiled bodyprocedure "%s": formal parameter "%s" has default value inconsistent with precompiled body" that is not a simple name" has formal parameter "" that is an array element" has argument with no nametoo many fields in argument specifier "procedure "%s": arg list contains %d entries, precompiled header expects %d ("uplevel" body line %d)?level? command ?arg ...?body object for proc attached to frame is not a byte code typebody of proc (compiling %s "%.*s%s", line %d)invoked "" outside of a loop (procedure "%.*s%s" line %d)TclUpdateReturnInfo: negative return levelerror while matching regular expression: REG_UBACKREFREG_ULOOKAHEADREG_UBOUNDSREG_UBRACESREG_UBSALNUMREG_UPBOTCHREG_UBBSREG_UNONPOSIXREG_UUNSPECREG_UUNPORTREG_ULOCALEREG_UEMPTYMATCHREG_UIMPOSSIBLEREG_USHORTESTREGEXPcouldn't compile regular expression pattern: okbad -level value: expected non-negative integer but got "bad completion code "": must be ok, error, return, break, continue, or an integer value: expected dictionary but got "expected dict but got "variable is not assigned by any conversion specifiersvariable is assigned by multiple "%n$" conversion specifiersfield size modifier may not be specified in % conversionfield width may not be specified in %c conversionunmatched [ in format stringunsigned bignum scans are invalidbad scan conversion character ""%n$" argument index out of rangedifferent numbers of variable names and field specifierscannot mix "%" and "%n$" conversion specifiersstring format ?varName varName ...?%lluTcl_SetStringObj called with shared objectTcl_AttemptSetObjLength called with shared objectTclAppendLimitedToObj called with shared objectTcl_AppendUnicodeToObj called with shared objectTcl_AppendStringsToObj called with shared objectformat string ended in middle of field specifier0xunsigned bignum format is invalidbad field specifier "%c"TclAppendFormattedObjs called with shared object?Y@@חAyAC7FnO8M?HwZ20Oujm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly q s s  s x  x x  x x x 1.2.3       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`file errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endĘԘ`l|`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@layoutpropertieslocaterestrictnewpositionmkunsupported property typemk4tcl._!%d._mkPropertymkCursor%s%d]Initialization error in dispatcherview index is negativeview index is too largeview index is out of rangeinsertrollbacksaveviewsasideautocommit-readonly-extend-nocommit-sharedfile already openfile open failedno such filenot a Metakit datafilecannot commit temporary datasetI/O error during commit-fullcannot rollback temporary datasetload from channel failedload errorsave to channel failedmk::file aside: needs 2 storage argsno storage with this namemk::file autocommit: too many argsstorage is not persistentunrecognized view nameno view with this nameno key specifiedkey not foundtoo few argswrong number of args ("mk::loop" body line %d)increment must be nonzero-min-max-keyword-first-count-sort-rsort-globncnot enough argumentsmk%dget cursor ?prop ...?set cursor prop ?value prop value ...?cursor option cursorname ?...?row option ?cursor ...?view option view ?arg?file option ?tag ...?loop cursor ?path first limit incr? {cmds}select path ?...?channel path prop ?mode?wrong # args: should be "mk::cursorrowselectmk::2.4.9.4 `12c4_TclStream8} @ |} d lt `D12SiasStrategybad args: must be prop value pairsfinddelete cursor ?cursor2?exists cursor ?prop ...?find ?prop value ...?insert cursor ?prop ...?open cursor propsearch prop valueselect ?..?size ?newsize?loop cursor ?first? ?limit? ?step? bodyview option ?args?wrong # args: should be "$obj bad property: must be a viewincrement has to be nonzeroblockedclonedifferentflattengroupbyhashindexedintersectminusorderedpairproductprojectunionuniqueconcat viewdifferent viewflatten propgroupby subview prop ?prop ...?hash map ?numkeys?indexed map unique prop ?prop ...?intersect viewjoin view prop ?prop ...?map viewminus viewordered ?numkeys?pair viewproduct viewproject prop ?prop ...?range start finish ?step?rename oprop nproprestrict....union viewwrong # args: should be "$obj view r+bw+b  h x , x ` ,  `@`,15c4_FileStrategy13c4_FileStream,4dhDt`bP| hl|n$s,s|ss@w$p``be hl|nh`p,s|ssww8`dLdxx^^^^^`Я``17c4_StreamStrategy13c4_DerivedSeq13c4_HandlerSeq10c4_Handler#N#,|} <Tdhlt^^`be^ hl|n^^^^^$s,s|ssww_`^p`а11c4_Sequence11c4_Strategy9c4_Stream \ȳ@#$8&P&\&Ŀ̿@Ŀ̿08Ŀ̿0Ŀ̿Ŀ̿8(|dTlĿ̿t $XĿ̿hX H|^^^Ŀ̿P`(e0hķp,s|sswwL `d\xxĶ|```pH`\H`DH`4H` H` H`H`H`ԳH13c4_JoinViewer17c4_JoinPropViewer16c4_GroupByViewer15c4_RenameViewer15c4_ConcatViewer13c4_PairViewer18c4_RemapWithViewer16c4_ProductViewer14c4_SliceViewer16c4_CustomHandler12c4_CustomSeq15c4_CustomViewer`bP| hl|nbPbbb$s,sbTc@w`Ha$p`UbCDhDlD|n$s,sDDpD`XhX4UxU$p`tD DbCDhDlD|n$s,sDDpDD8G;4=$p`tD`(``13c4_ProjectSeq10c4_SortSeq12c4_FilterSeq,[][]_C_O_D_K_R_B_C[_O:I,_D[_K:I,_R:I,_B:B]]H_H6@8P;h;;d=x=??'P(***,,./t`hl,HDXd\DTEF4FPFFĿ̿`H`ԷH`H`H`H16c4_IndexedViewer16c4_OrderedViewer16c4_BlockedViewer13c4_HashViewer17c4_ReadOnlyViewerlyT{P܁$hpGD`ėh^Xm`rrru\l[pG^T,W@Yh^Xm`ghjk\l[pG^Hܖp0ALdtEF#lG'tć|GHDJ0LX,)Y86Th3o@yȠz,<Р | Eؠ{P~J,D\T4 X% 0GG ȭE aH  ܜ$(P 4x(T@HP X ` d|lhd'|L-pԝxFDhz`eȡ`_^bD(H@^X bpDcТ_`tf0H_H``x08ffȺأctc @8@`,РܬP\hpX,h`llt|Lȯԯ@ $ؠ,p4M<DP\ܦ@4,(  h(08LX`h|̷ط (08̷(4@(H4\T`0lH4\T`0lHTĽ0̽Խܽ(08`J@HPX`T9hpxط lTTĽ0̽Խܽ(08DP`lx,4DXhxx (04HTԟdt(8HXdt  ,< L\dpLoHo  000 0(4<xTP, hI<aXf|D$xLP >\ ,l4500`hlta`c T<DTԽ|$x   -t| |@:@ K@LT`hpl 2112l24288d8(8 4l$,,<HX`hp|ll,ԝ 4$,,<Hl,ԝܬ4D D+tlT\dl<h"#|$"(# dԜd'Ԝ0Tx4| e x e@ D D D t JJ K ̸ < 8  l [\\xXy\|T l D<  8  l *lx44\@ P'')x)h-2d2|3d>==,>@ ATAexpandtxh4l , d8 dD dL X dd dt d     |    <4$H4077778 8@8(888D8P8\8l8 |88%Ƞԟԩ:U S T S Ϻ  h Ϻhgg| dhP L 0( ( < , Th<t @ |D